KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1240cHelp
Entry
Spy49_1240c       CDS       T00780                                 

Definition
(GenBank) Histidine kinase
  KO
K07706  two-component system, LytTR family, sensor histidine kinase AgrC [EC:2.7.13.3]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz02020  Two-component system
soz02024  Quorum sensing
Module
soz_M00495  AgrC-AgrA (exoprotein synthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:soz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spy49_1240c
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Spy49_1240c
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Spy49_1240c
Protein kinases [BR:soz01001]
 Histidine kinases
  LytTR family [OT]
   Spy49_1240c
Two-component system [BR:soz02022]
 LytTR family
  AgrC-AgrA [MD:M00495]
   Spy49_1240c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_5 PIG-F
Motif
Other DBs
NCBI-ProteinID: ACI61526
UniProt: A0A0H3BZ60
Position
complement(1241384..1242739)
Genome map
AA seq 451 aa AA seqDB search
MLEDFLQFLGFIFLDIIEIMLTLKLFSFVSAIPLRLKNIFYLSLSMVLFQVVFWAFFPDH
FILDVVMLAQFLFFALIALYYGKSIKAKFLMFYAFFPLVSISLVKRFIVFFVMPLFGMPY
SVVKHNTLLIYSITCFSIFLIYRCIQVFHFDFSTWRQYFQSHRASKLLVFTNSSMALYYL
CVQGIDVMSPSLSGLATTTARSIIVLFYFILFLTLLIHLERYVKQNSIEAIVQQKEYREL
INYSQHLGLLYQDIQELRQLLTTVSSRLKIGIEQNDISIVRLTYEGILNAEKNNAKDDRL
DLTCLDKLQVEAIRHIVLAKLIEAKNKKLKVEVSIPNCIATFFLEVVDFTKLLSFLLDNA
IEMSLETKQPCLSIAFLDQNHKLVIVIQSSTKQGQDDSQSVFAIPALKKRDDWQFDLRNV
TTILNRYDYLTISSQIHDGILTQLIEIAKPD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagattttcttcaatttttaggatttatatttttagatattattgaaattatg
ttaacattaaagctttttagctttgtaagtgcaattccgcttcgcctgaaaaatattttt
tatttatcacttagtatggttttgtttcaagtagttttttgggctttctttccagaccat
ttcatccttgatgttgtgatgttggctcagtttcttttctttgcgcttatagccctatac
tatggtaaatcaataaaagctaagtttttaatgttttatgccttttttccactagtgtct
attagtttggttaagcgatttattgtattttttgttatgccattgtttggtatgccttat
tcagttgttaaacataatacactactgatttacagcattacttgctttagtatttttttg
atttatcgctgcattcaagtttttcatttcgatttttcaacctggcgccaatattttcaa
tcacatagagctagtaaactattagtgtttactaactcttcgatggctctatattacttg
tgtgtccaagggatagatgtgatgtcgccttctttatcaggacttgctacaacgactgct
cgttcaatcatagtgctcttttatttcattttgtttcttactttattaattcatttagag
cgttatgtaaaacaaaactctattgaggcaattgtgcaacaaaaagaatatcgtgagctg
attaattatagtcagcaccttggattgctgtatcaagatattcaagagcttaggcagcta
ttaactaccgtgtccagtcgtcttaagattggaatcgaacaaaatgatatctctattgtg
agacttacttatgaaggtatcttgaatgctgaaaagaataatgctaaagatgacagactt
gatttaacttgtttagataaattacaagttgaagcaatcagacatattgttttagctaaa
ttaattgaggcaaaaaataagaagcttaaggttgaggtatcgatccctaattgtattgca
acgttttttctagaagtagtagatttcactaagctattgtcatttttgttagataatgct
atagaaatgagtttggagacaaagcaaccttgcttatcaatagcatttctggatcaaaac
cataaacttgtcatagtcattcaaagcagtactaaacaaggacaagatgatagtcaaagc
gtgtttgctataccggctttgaaaaaaagagatgactggcaatttgacttaaggaatgtc
acgaccattttaaatcgttatgactatctcacaattagctcgcagattcatgatggcatt
ttaacccagttaatagaaatagctaagcctgactga

DBGET integrated database retrieval system