KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1242Help
Entry
Spy49_1242        CDS       T00780                                 

Gene name
recX
Definition
(GenBank) Regulatory protein recX
  KO
K03565  
regulatory protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
DNA repair and recombination proteins [BR:soz03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Spy49_1242 (recX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1244875..1245651
Genome map
AA seq 258 aa AA seqDB search
MKITKIEKKKRLYLIELDNDESLYVTEDTIVRFMLSKDKVLDNDQLEDMKHFAQLSYGKN
LALYFLSFQQRSNKQVADYLRKHEIEEHIIADIITQLQEEQWIDDTKLADTYIRQNQLNG
DKGPQVLKQKLLQKGIASHDIDPILSQTDFSQLAQKVSQKLFDKYQEKLPPKALKDKITQ
ALLTKGFSYDLAKHSLNHLNFDQDNQEIEDLLDKELDKQYRKLSRKYDGYTLKQKLYQAL
YRKGYNIDDINCKLRNYL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactaaaattgaaaagaaaaaacgcctctaccttatcgaattggataatgac
gaatccctttatgtaacagaagatactattgttcggtttatgttgagtaaagataaagtc
cttgacaatgatcagcttgaagacatgaaacattttgcccaactgtcctacggcaaaaat
ttagccctttattttctttcctttcaacaacgcagcaacaagcaagttgctgattacctg
cgcaagcatgagattgaagaacacattattgctgacatcatcactcaactccaagaagaa
caatggatagacgacaccaaattggctgatacctacattcgccaaaatcagttaaatggt
gataaaggtccccaagtcttaaaacaaaaattattacaaaaaggcattgcaagtcatgac
attgatcctatcttatctcaaactgactttagccaactcgctcaaaaagtaagccaaaaa
ctctttgacaaatatcaagaaaaattgccaccaaaagccttgaaagataaaatcacccaa
gcattactgaccaaaggcttttcatacgatctagctaaacatagcctcaatcaccttaat
tttgaccaagataatcaagaaatagaagatcttcttgacaaagaattagacaaacaatat
cgtaaactcagtcgcaaatatgatggttataccttaaagcaaaagctctatcaggctctc
taccgaaaaggctacaacatcgacgatattaattgcaagttaagaaattatttatag

DBGET integrated database retrieval system