KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1245Help
Entry
Spy49_1245        CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI61531
UniProt: A0A0H3C1H2
Position
1246927..1247034
Genome map
AA seq 35 aa AA seqDB search
MNSLHVRKTDKIETETLAQSQFVLNRKPTHVQEEV
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagcctgcacgttcgtaaaacagacaaaattgaaactgaaacactagctcaatct
caatttgtactaaatcgtaaaccaactcatgtccaagaagaagtctaa

DBGET integrated database retrieval system