KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1247cHelp
Entry
Spy49_1247c       CDS       T00780                                 

Definition
(GenBank) Ribosomal subunit interface protein
  KO
K05808  putative sigma-54 modulation protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Ribosome biogenesis [BR:soz03009]
 Prokaryotic Type
  Other maturation factors
   Spy49_1247c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S30AE Ribosom_S30AE_C
Motif
Other DBs
NCBI-ProteinID: ACI61532
UniProt: A0A0H3BY45
Structure
PDB: 

Jmol
Position
complement(1254000..1254548)
Genome map
AA seq 182 aa AA seqDB search
MIKFSIRGENIEVTEAIRDYVESKLTKIEKYFAKDQEIDARVNLKVYRERSSKVEVTIPL
DSVTLRAEDVSXDMYGSIXLVVDKIERQIRKNKTKIAKKHREKVPTGQVFTTEFEAEEVD
EIPEVQVVRTKNVTLKPMDVEEARLQMELLGHDFFIYTDSEBGATNILYRREDGNLGLIE
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttcagtattcgtggagaaaatatcgaagtgacagaagctattcgcgattat
gtagaatcaaagcttactaaaatcgaaaaatattttgctaaagaccaagaaatagatgca
cgtgttaatttaaaagtttatcgggagagatcttcaaaagttgaggtaacgatcccatta
gattcagtaacccttcgtgctgaagatgtttcmcrggatatgtacggctctattgrktta
gttgttgataagatcgaacgccaaattagaaaaaataaaaccaaaattgctaaaaaacat
cgcgaaaaggttccaactggtcaagtctttacaactgagtttgaagctgaagaagtcgat
gagataccagaagtacaagttgtacgtactaaaaatgtgacattaaaaccaatggatgtt
gaagaagcgcgtttacagatggaactattgggacatgatttctttatctacactgattct
gaaratggygcaacaaacattttataccgtcgcgaagatggaaacctaggattaatagaa
gctaaatag

DBGET integrated database retrieval system