KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1248cHelp
Entry
Spy49_1248c       CDS       T00780                                 

Gene name
comF
Definition
(GenBank) Putative late competence protein
  KO
K02242  competence protein ComFC
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Module
soz_M00429  Competence-related DNA transformation transporter
Brite
Secretion system [BR:soz02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   Spy49_1248c (comF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_3 PRTase_2 UPRTase
Motif
Other DBs
NCBI-ProteinID: ACI61533
UniProt: A0A0H3BZ66
Position
complement(1254628..1255293)
Genome map
AA seq 221 aa AA seqDB search
MICLLCQQISQTPISITEIIFLRRISSPICQQCQKSFQKIGKSVCATCCANSDIIACRDC
LKWENKGYNVNHRSLYCYNAAMKAYFSQYKFQGDYLLRKVFAVELADVITKYYKGYIPVP
VPVSPGCFRERQFNQVSAILEAANVIYLSLFEKLDNTHQSSRTKKERLLVEKSYRLLKVS
NIPDKILIVDDIYTTGSTIIALRKQLAKVANSDIKSLSIAR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtctactatgtcaacaaattagtcaaacaccaataagtattacagaaatcatc
tttttaaggcgtatctcttcaccgatttgtcaacaatgtcaaaaaagctttcaaaagata
ggaaaaagtgtttgtgcgacatgttgtgcaaactcagatataatagcttgtcgagattgt
ctaaaatgggaaaacaaaggatacaatgtaaatcatagaagcttatattgttataatgct
gctatgaaagcatacttcagtcaatataagtttcaaggagactatttattaagaaaagtt
tttgcagtagaacttgccgatgttattaccaagtactataaaggctatatcccagtcccg
gttcctgtaagtcccggttgttttcgagaaagacaatttaatcaagtgagcgctattctt
gaggcagctaatgttatctacctttctctttttgaaaagctagataatactcaccaatct
tccagaacaaaaaaagagagattattagtagaaaaatcttatcgactactaaaagtatca
aacattcctgataaaatccttatagtagatgatatttatactactggtagtacaattatc
gctcttagaaaacaattggctaaagtagcaaatagtgacattaaaagtttgtcaattgca
cgttaa

DBGET integrated database retrieval system