KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1756cHelp
Entry
Spy49_1756c       CDS       T00780                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:soz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1747539..1748135)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTHSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYTATELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacacatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
ggttttcacacggaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttatacagcaacagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system