KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1808Help
Entry
Spy49_1808        CDS       T00780                                 

Gene name
hasC
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spy49_1808 (hasC)
   00052 Galactose metabolism
    Spy49_1808 (hasC)
   00500 Starch and sucrose metabolism
    Spy49_1808 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    Spy49_1808 (hasC)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spy49_1808 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1798433..1799347
Genome map
AA seq 304 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAPQD
KAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQTPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPEVKEDLKNYIIKLGKALEKSKVP
THSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgctgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaggactatgacaagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaagac
aaggctgtcaagggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacagacccctggagcaggtaacgaagtgcaactcacagatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaatttaaaggcaatcgttacgatgttggg
gataaatttggattcatgaaaacatctatcgactatgccttagaacacccagaggtcaaa
gaggacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtaaagtacca
acacattcaaagtaa

DBGET integrated database retrieval system