KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0088Help
Entry
M6_Spy0088        CDS       T00191                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M6_Spy0088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0088
   00620 Pyruvate metabolism
    M6_Spy0088
   00650 Butanoate metabolism
    M6_Spy0088
  Lipid metabolism
   00071 Fatty acid degradation
    M6_Spy0088
  Amino acid metabolism
   00350 Tyrosine metabolism
    M6_Spy0088
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M6_Spy0088
   00626 Naphthalene degradation
    M6_Spy0088
Enzymes [BR:spa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M6_Spy0088
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M6_Spy0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
99346..101988
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFDNLEKSVKTADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIQMNFKAQGIDENEWKEHSRELA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataatactgttgaaacaacctctgtttctgtgacaattgatgctctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttgaccaagaacaagttgac
tatatcgtagcaaaagcttctgttgctgccttggatgcacacggagaacttgctaaacat
gcttacgaagaaacaggtcgtggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtaggaattattgaagaggat
gacgtgacaggtttgacgttgattgctgagccggttggtgttatctgtgggattacacca
acaactaacccaacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaattatttttgcctttcacccatcagcacaagaatcatcagcacatgccgctcgtatt
gttcgtgatgctgctattgccgctggtgctcctgaaaattgtgtgcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgacggcattgccactatccttgcg
acaggtggaaatgcgatggttaaagcagcttactcatgtggaaaacctgctcttggggta
ggtgcaggtaatgttccagcctatgtggaaaaatctgctaatatccgtcaagccgctcat
gatattgtgatgtctaaatcatttgataatggtatggtctgtgcctctgaacaagctgtt
atcatcgataaagaaatctatgacgattttgtagcagaattcaaatcttaccacacttat
tttgttaataaaaaagaaaaagctcttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgtaggaaaaccagctacttgg
attgcagcacaagctggatttactgttccagaaggaacgaatattcttgctgcagaatgt
aaagaagtttcagaaaatgagcctttaacacgtgaaaaattatctccagtcattgctgtt
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggacttggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttgga
actagaatccgtgctatccgcgtcatctggaattcaccttctacatttggtggtatcggg
gatgtttacaatgctttcttaccatcattgactcttggttgtggttcgtatggacgtaac
gcagttggtgataacgttagtgctataaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgtgattcaatt
caatatttgcaaaaatgtcgtgatgttgaacgtgtcatgattgttacagatcacgctatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatctttgctgaagtagaaccagatccagacattacaactgttatgaaaggt
actgaattaatgcgtaccttcaaaccagacaccattattgcccttggcgggggatctcct
atggatgcagccaaagttatgtggctcttttatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgcaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctatcccaacaacttctggaacaggttcagaggtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattactcattaaca
ccaactgtagccattgttgacccagctttggtattgactgttccaggctttattgctgct
gatactggtatggacgttttgacacacgcaaccgaagcttacgtgtcacaaatggccaat
gactttacggatggtttagctcttcaagccattaaaattgtttttgataatcttgaaaaa
tcagttaaaacagccgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacggcgacatggcctaagtataattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttagggcttccagcttctacaccagaagaa
gcagtggaatcttatgcgaaagctgtttatgatctgggttgccgagttggtattcaaatg
aacttcaaagctcaaggtatcgacgaaaatgaatggaaagaacattctcgtgaattggct
taccttgcttatgaagaccaatgttcacctgctaacccacgtcttccaatggttgatcac
atgcaagaaattattgaagatgcttactatggttatgctgaacgtccaggacgacgtaag
tga

DBGET integrated database retrieval system