KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0124Help
Entry
M6_Spy0124        CDS       T00191                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128293..128520
Genome map
AA seq 75 aa AA seqDB search
MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAATVLMTGSGP
TVFALCQTEKQTIIV
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgtctactactcatttggttgcggcgattgaagcgggtaactataatgatgggatattg
actgaaatgaacaatttgctggaagatattttcattgccaagcgaccctttattcaaaaa
ataaaagagaaaacactacaagctggtgctgctactgttttgatgacaggaagtggaccg
actgtttttgctttgtgccaaaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system