KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0224Help
Entry
M6_Spy0224        CDS       T00191                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00040  Pentose and glucuronate interconversions
spa00052  Galactose metabolism
spa00500  Starch and sucrose metabolism
spa00520  Amino sugar and nucleotide sugar metabolism
spa01100  Metabolic pathways
spa01130  Biosynthesis of antibiotics
Module
spa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M6_Spy0224
   00052 Galactose metabolism
    M6_Spy0224
   00500 Starch and sucrose metabolism
    M6_Spy0224
   00520 Amino sugar and nucleotide sugar metabolism
    M6_Spy0224
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M6_Spy0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAT86359
UniProt: Q5XE04
Position
complement(230304..231209)
Genome map
AA seq 301 aa AA seqDB search
MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTG
KSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKT
FVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP
QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTK
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttt
ttacctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactatt
caatttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactgga
aaatccaaacgttccatagaagatcattttgattctaattttgaattagaatataattta
caggctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatctt
cactttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacc
tttgttggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaat
ccaaatgtaaaaccattaactaaacaattgatcgatgactatgaagaaactcatgccgca
accattgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcct
caagcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacct
caagatgcacctagtgatttagcaattattggacgttacttgctcacaccagaaattttt
agtattttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctatt
gataccctcaataaaacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgat
gttggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacatcctcaa
gtcaaagatgacttgaaagcctacatcatccaactgggcaaagcactagagaaaacaaaa
ccataa

DBGET integrated database retrieval system