KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0265Help
Entry
M6_Spy0265        CDS       T00191                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M6_Spy0265
   01230 Biosynthesis of amino acids
    M6_Spy0265
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0265
Enzymes [BR:spa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     M6_Spy0265
Exosome [BR:spa04147]
 Exosomal proteins
  Proteins found in most exosomes
   M6_Spy0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272238..273275
Genome map
AA seq 345 aa AA seqDB search
MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQ
GRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLH
ANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQ
KGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDG
AAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSSDIVGVSYGSL
FDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgattttcataaggaggaaatcactaatggtagttaaagttggtattaacggtttcggt
cgtatcggacgtcttgcattccgccgtattcaaaacatcgaaggtgttgaagtaactcgt
atcaatgaccttacagatccaaatatgcttgcacacttgttgaaatacgatacaactcaa
ggtcgttttgatggaacagttgaagttaaagaaggtggatttgaagtaaacggaaacttc
atcaaagtttctgctgaacgtgatccagaaaacatcgactgggcaactgatggggttgaa
atcgttcttgaagcaactggtttctttgctaaaaaagaagcagctgaaaaacacttacat
gctaacggtgctaaaaaagttgttatcacagctcctggtggaaacgatgttaaaacagtt
gttttcaacactaaccacgacattcttgacggtactgaaacagttatctcaggtgcttca
tgtactacaaactgtttagctcctatggctaaagctcttcacgatgcattcggtattcaa
aaaggtcttatgactacaatccacgcttacactggtgaccaaatgatccttgacggacca
caccgtggtggtgatcttcgtcgtgcacgcgctggtgctgcaaatatcgttcctaactca
actggtgctgctaaagctatcggtcttgttatcccagaacttaacggtaaacttgacggt
gctgcacaacgtgttcctgttccaactggatcagtaactgagttggttgtaactcttgac
aaaaacgtttctgttgacgaaatcaacgctgctatgaaagctgcttcaaacgatagcttc
ggttacactgaagatccaatcgtttcttcagatatcgtaggcgtatcatacggttcattg
tttgacgcaactcaaactaaagtaatggaagttgacggatcacaattggttaaagttgta
tcatggtatgacaacgaaatgtcttacactgctcaacttgtacgtactcttgagtacttc
gcaaaaattgctaaataa

DBGET integrated database retrieval system