KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0265Help
Entry
M6_Spy0265        CDS       T00191                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:spa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272238..273275
Genome map
AA seq 345 aa AA seqDB search
MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQ
GRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLH
ANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQ
KGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDG
AAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSSDIVGVSYGSL
FDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgattttcataaggaggaaatcactaatggtagttaaagttggtattaacggtttcggt
cgtatcggacgtcttgcattccgccgtattcaaaacatcgaaggtgttgaagtaactcgt
atcaatgaccttacagatccaaatatgcttgcacacttgttgaaatacgatacaactcaa
ggtcgttttgatggaacagttgaagttaaagaaggtggatttgaagtaaacggaaacttc
atcaaagtttctgctgaacgtgatccagaaaacatcgactgggcaactgatggggttgaa
atcgttcttgaagcaactggtttctttgctaaaaaagaagcagctgaaaaacacttacat
gctaacggtgctaaaaaagttgttatcacagctcctggtggaaacgatgttaaaacagtt
gttttcaacactaaccacgacattcttgacggtactgaaacagttatctcaggtgcttca
tgtactacaaactgtttagctcctatggctaaagctcttcacgatgcattcggtattcaa
aaaggtcttatgactacaatccacgcttacactggtgaccaaatgatccttgacggacca
caccgtggtggtgatcttcgtcgtgcacgcgctggtgctgcaaatatcgttcctaactca
actggtgctgctaaagctatcggtcttgttatcccagaacttaacggtaaacttgacggt
gctgcacaacgtgttcctgttccaactggatcagtaactgagttggttgtaactcttgac
aaaaacgtttctgttgacgaaatcaacgctgctatgaaagctgcttcaaacgatagcttc
ggttacactgaagatccaatcgtttcttcagatatcgtaggcgtatcatacggttcattg
tttgacgcaactcaaactaaagtaatggaagttgacggatcacaattggttaaagttgta
tcatggtatgacaacgaaatgtcttacactgctcaacttgtacgtactcttgagtacttc
gcaaaaattgctaaataa

DBGET integrated database retrieval system