KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0530Help
Entry
M6_Spy0530        CDS       T00191                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M6_Spy0530 (tpiA)
   01230 Biosynthesis of amino acids
    M6_Spy0530 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0530 (tpiA)
   00051 Fructose and mannose metabolism
    M6_Spy0530 (tpiA)
   00562 Inositol phosphate metabolism
    M6_Spy0530 (tpiA)
Enzymes [BR:spa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M6_Spy0530 (tpiA)
Exosome [BR:spa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M6_Spy0530 (tpiA)
  Exosomal proteins of bladder cancer cells
   M6_Spy0530 (tpiA)
  Exosomal proteins of melanoma cells
   M6_Spy0530 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521469..522227
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEARAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
AGSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
agagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctggtagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system