KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0819Help
Entry
M6_Spy0819        CDS       T00191                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M6_Spy0819 (folE)
Enzymes [BR:spa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     M6_Spy0819 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824946..825554
Genome map
AA seq 202 aa AA seqDB search
MKRKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGL
GKDPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLA
RAVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTT
ARGLYKESRAERQEVISLMTKD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaa
aaagcagaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaa
ggtcttcttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactg
ggaaaagatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtg
attgtcaaagacattagtttttattctatatgtgaacaccacttagttcctttttatggc
aaggctcatatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcg
cgagcagttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaata
gcggatgctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagag
cacatgtgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccact
gccagaggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgaca
aaagattag

DBGET integrated database retrieval system