KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0822Help
Entry
M6_Spy0822        CDS       T00191                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M6_Spy0822
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     M6_Spy0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826726..827226
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQSDLKLPPNHKFLRDYLAALDQSDITLFSAQQTEF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgggggaccgagcagcttacttgcaa
aaagctcttgaggctttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacgactgcttggggcaagacaggccaggctgattttctcaatatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagtcagatttaaaattgcctcctaat
cataagtttttaagggattatcttgcagctttagatcaatcagatatcacgctcttttca
gctcaacagacagagttctag

DBGET integrated database retrieval system