KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0833Help
Entry
M6_Spy0833        CDS       T00191                                 

Definition
Zn-dependent alcohol dehydrogenase and related dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:spa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:spa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:spa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:spa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:spa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(837238..838170)
Genome map
AA seq 310 aa AA seqDB search
MNWLITSQPYKELNMKAATYLSTGNLQLIDKPKPVIIKPTDAIVQVVKTTICGTDLHILG
GDVPACKEGTILGHEGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCED
GGWILGHLINGTQAEYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKP
GDNVCIVGAGPVGLAALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKA
IIDDITNGRGVDISMECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNIT
LNTPIQLKCY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgattacctctcaaccttataaggagttaaatatgaaagcagcaacttac
ctttcaaccggaaatctacagctcatagacaaaccaaaaccagtcattataaagcctaca
gatgctatcgtccaggtggtaaaaaccactatttgtggaactgatttgcatatcttaggt
ggggatgttcccgcatgtaaagaaggaacaatccttggtcatgaaggaattggaattgtt
aaggaggtcggtgatgcggtcactaactttaaaatcggagataaagtgattatttcttgc
gtcacatcatgtcatacctgttattattgtaaacgaggcctttcgtcacattgtgaagat
ggcggttggattcttggccatttaattaatggaacacaagcagaatatgtccatatccca
catgcagatggtagtctctatcatgctcctgatacgattgatgatgaggcactggtcatg
ctttctgatattttaccaacttcatatgaaattggtgtcttgccatcacatgtcaagcct
ggagataatgtttgtattgttggtgccggtccagtaggactcgcagccctactaaccgtt
caatttttctctccagccaatattattatggtcgacttatctcaaaatcgccttgaagca
gctaaaacgtttggagccacacacacgatttgttcaggaagtagtgaagaagtcaaggct
atcattgacgatataaccaatggacgtggtgtcgatatttccatggagtgtgttggttat
cccgcgacatttgatatttgtcaaaaaattatatcagtaggtgggcatattgctaacgtt
ggggttcatgggaaaccagttgatttcaacctggatgaattatggattaaaaatatcacc
ttaaacacgccaatacaactgaaatgctactaa

DBGET integrated database retrieval system