KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0833Help
Entry
M6_Spy0833        CDS       T00191                                 

Definition
Zn-dependent alcohol dehydrogenase and related dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M6_Spy0833
Enzymes [BR:spa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     M6_Spy0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(837238..838170)
Genome map
AA seq 310 aa AA seqDB search
MNWLITSQPYKELNMKAATYLSTGNLQLIDKPKPVIIKPTDAIVQVVKTTICGTDLHILG
GDVPACKEGTILGHEGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCED
GGWILGHLINGTQAEYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKP
GDNVCIVGAGPVGLAALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKA
IIDDITNGRGVDISMECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNIT
LNTPIQLKCY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgattacctctcaaccttataaggagttaaatatgaaagcagcaacttac
ctttcaaccggaaatctacagctcatagacaaaccaaaaccagtcattataaagcctaca
gatgctatcgtccaggtggtaaaaaccactatttgtggaactgatttgcatatcttaggt
ggggatgttcccgcatgtaaagaaggaacaatccttggtcatgaaggaattggaattgtt
aaggaggtcggtgatgcggtcactaactttaaaatcggagataaagtgattatttcttgc
gtcacatcatgtcatacctgttattattgtaaacgaggcctttcgtcacattgtgaagat
ggcggttggattcttggccatttaattaatggaacacaagcagaatatgtccatatccca
catgcagatggtagtctctatcatgctcctgatacgattgatgatgaggcactggtcatg
ctttctgatattttaccaacttcatatgaaattggtgtcttgccatcacatgtcaagcct
ggagataatgtttgtattgttggtgccggtccagtaggactcgcagccctactaaccgtt
caatttttctctccagccaatattattatggtcgacttatctcaaaatcgccttgaagca
gctaaaacgtttggagccacacacacgatttgttcaggaagtagtgaagaagtcaaggct
atcattgacgatataaccaatggacgtggtgtcgatatttccatggagtgtgttggttat
cccgcgacatttgatatttgtcaaaaaattatatcagtaggtgggcatattgctaacgtt
ggggttcatgggaaaccagttgatttcaacctggatgaattatggattaaaaatatcacc
ttaaacacgccaatacaactgaaatgctactaa

DBGET integrated database retrieval system