KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0976Help
Entry
M6_Spy0976        CDS       T00191                                 

Definition
(GenBank) Non-allosteric 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00010  Glycolysis / Gluconeogenesis
spa00030  Pentose phosphate pathway
spa00051  Fructose and mannose metabolism
spa00052  Galactose metabolism
spa00680  Methane metabolism
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01120  Microbial metabolism in diverse environments
spa01130  Biosynthesis of antibiotics
spa01200  Carbon metabolism
spa01230  Biosynthesis of amino acids
spa03018  RNA degradation
Module
spa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0976
   00030 Pentose phosphate pathway
    M6_Spy0976
   00051 Fructose and mannose metabolism
    M6_Spy0976
   00052 Galactose metabolism
    M6_Spy0976
  Energy metabolism
   00680 Methane metabolism
    M6_Spy0976
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    M6_Spy0976
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M6_Spy0976
Protein phosphatases and associated proteins [BR:spa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     M6_Spy0976
Messenger RNA biogenesis [BR:spa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     M6_Spy0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAT87111
UniProt: Q5XBV2
Position
complement(979866..980879)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggtgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatctcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgagggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagcggtgaagcttttgctcaaaaactgaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system