KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0976Help
Entry
M6_Spy0976        CDS       T00191                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M6_Spy0976 (pfkA)
   01230 Biosynthesis of amino acids
    M6_Spy0976 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0976 (pfkA)
   00030 Pentose phosphate pathway
    M6_Spy0976 (pfkA)
   00051 Fructose and mannose metabolism
    M6_Spy0976 (pfkA)
   00052 Galactose metabolism
    M6_Spy0976 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    M6_Spy0976 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    M6_Spy0976 (pfkA)
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M6_Spy0976 (pfkA)
Protein phosphatases and associated proteins [BR:spa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     M6_Spy0976 (pfkA)
Messenger RNA biogenesis [BR:spa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     M6_Spy0976 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(979866..980879)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggtgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatctcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgagggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagcggtgaagcttttgctcaaaaactgaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system