KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1043Help
Entry
M6_Spy1043        CDS       T00191                                 

Definition
D-alanine--poly(phosphoribitol) ligase subunit 1 (EC:6.1.1.13)
Orthology
K03367  
D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
D-Alanine metabolism
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M6_Spy1043
Enzymes [BR:spa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     M6_Spy1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1035709..1037247)
Genome map
AA seq 512 aa AA seqDB search
MIKDMIDSIEQFAQTQADFPVYDCLGERRTYGQLKRDSDSIAAFIDSLALLAKSPVLVFG
AQTYDMLATFVALTKSGHAYIPVDVHSAPERILAIIEIAKPSLIIAIEEFPLTIEGISLV
SLSEIESAKLAEMPYERTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEDA
AFDVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTLFALPKELVADFKQLFTTIAQLPVGI
WTSTPSFADMAMLSDDFCQAKMPALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTE
ATVALSAIEITREMVDNYTRLPIGYPKPDSPTYIIDEDGKELSSGEQGEIIVTGPAVSKG
YLNNPEKTAEAFFTFKGQPAYHTGDIGSLTEDNILLYGGRLDFQIKYAGYRIELEDVSQQ
LNQSPMVASAVAVPRYNKEHKVQNLLAYIVVKDGVKERFDRELELTKAIKASVKDHMMSY
MMPSKFLYRDSLPLTPNGKIDIKTLINEVNNR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggatatgattgacagtattgagcagtttgctcagacacaggctgatttccca
gtttatgattgtttaggggaacgccgcacttacggacaactcaaaagagattctgatagc
attgctgcatttatagatagcttagctttactggcaaaatctccagttttggtttttggg
gcgcaaacttatgatatgttagctacttttgtagctttaaccaaatctggtcatgcctat
atcccagtagatgtgcattcagcaccagaacgtattttagcgattattgagattgcaaag
cccagtttaatcattgctattgaggaattccctcttactattgaagggatttcccttgtc
tcactatcagagattgagtcagcaaaattagcagaaatgccctatgagcgaacacattct
gttaaaggagatgataattattacattattttcacctctggaacaacgggccaaccaaaa
ggggtgcaaatttcacatgacaatcttttgagctttaccaactggatgatcgaagatgca
gcatttgatgtacctaaacagccacaaatgctggcgcagccaccctattcctttgacctt
tctgtcatgtactgggcacctaccttggctttaggtggaaccttatttgcacttccaaaa
gaattggtggcagactttaaacagttatttacaacgattgcgcaacttccagttggcatt
tggacatcgactccttcatttgctgatatggccatgcttagcgatgatttttgccaggct
aagatgccagctttaacgcatttttattttgatggcgaagaattaaccgtttctacggct
cgaaaactctttgaacgtttcccgagtgccaagattatcaatgcctatggaccaacagaa
gcgactgtagccttatccgctattgaaattactagagaaatggtggataattatacccgc
ttgccgattggctaccccaaaccagattctccgacctatattattgatgaagatggtaag
gagttatcttcaggggagcagggtgaaattattgttacagggcctgctgtgtcaaaaggt
tacctcaacaatcctgagaaaaccgcagaagctttctttacttttaaaggacagcctgct
tatcatacaggggacattggctcattgacagaagataatattttgctgtatggtgggcgt
ttggattttcagattaaatatgctggttatcgtatcgaactagaagatgtttcccaacag
ttgaatcaatcaccaatggtagcatcggctgtggctgttccaaggtacaataaagaacat
aaggttcaaaatctcttggcctatatcgttgtcaaagatggggttaaagagcgttttgat
agggaattggagttaaccaaagctatcaaagcctctgttaaggatcatatgatgagttat
atgatgccttctaagtttctttatcgagacagtctaccattaactccaaatggtaagata
gatattaaaactttgattaatgaggtcaataaccgatga

DBGET integrated database retrieval system