KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1054Help
Entry
M6_Spy1054        CDS       T00191                                 

Definition
Beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048937..1050361)
Genome map
AA seq 474 aa AA seqDB search
MSKERTKDMKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHH
QIGPEKTSTFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQD
IIAQGIKLIVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEP
IVPVECGYLGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAY
PRSDAPEDVKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEVIKNN
TVDFLGVNYYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDI
ALNLKEHYGNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANC
KGYLLWTFIDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaagaaaggacaaaggatatgaaacaaagaaaacaccgttatcaatttccagat
ggctttttatggggaagttccacatctgggcctcaaagcgaaggaacggttcctggagat
ggcaaaggacctagcaactgggattactggtttagtattgagtcagctaagtttcatcac
caaattggtccagaaaaaacctcaaccttttatgaaaactataaaggtgacattgccctt
ttgaaagaaacaggtcacacgatttttcggacctcaatccagtggtctcgattgattcca
gaaggagtcggggaggttaatccaaaggcggtgacattttaccgagaagtatttcaagac
attattgctcaaggtattaaattgattgttaacctctatcattttgacctcccctatgcc
ttgcaagaaaaaggtggctgggaaaacaaagctactgtctgggcttatgaaacctacgca
aaaacctgttttgagctttttggtgatttagtaaacacttggattacctttaatgaaccg
attgttccagtcgaatgtggctatttaggttattatcactacccttgtaaagtagatgcc
aaggcagcagttcaagtggcttacaacacacaactggccagttcactggcggttaaagct
tgtcataagcttcatcccgaccacaagattagtattgtgcttaacatgacacctgcttat
cctcggagtgatgctcctgaagatgtcaaggctgctagaatcgcagagcttttccaaacc
aaatccttcctagatccatcagttttgggtgtgtacccagcagagttagtttccatttta
gaggaagctgatttattacctcaatatagtgctgatgaattagaggttatcaaaaacaat
actgttgattttttgggagttaattattatcagcctttgcgggttcaggcacctagtaag
tcacagcaagagggggacccccttatcttagatatttattttgaaccttatgatatgcct
ggtaaaaaagtcaatcctcaccggggttgggaaatttatgaaccaggactttatgatatt
gcccttaatttaaaagaacactatggtaacatcgaatggctagtcacggaaaatggtatg
ggtgtcgaaggtgaagaagcttttttagcagatggccagatacaagatgactaccgcatc
acctttatcgaggatcatcttatccagcttcataaggctttgggagaaggagccaactgc
aaaggctacctcttgtggacttttattgattgctggtcttggttaaatgcttataaaaac
cgatatggtttggtagctttggatttagagagtcaaaagcgaaccataaaaaaatcaggt
tactggtttaaggcgttgagcgagtcaaatggttttgataaatag

DBGET integrated database retrieval system