KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1186Help
Entry
M6_Spy1186        CDS       T00191                                 

Definition
(GenBank) RecR
  KO
K06187  
recombination protein RecR
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M6_Spy1186
DNA repair and recombination proteins [BR:spa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     M6_Spy1186
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M6_Spy1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1192080..1192766)
Genome map
AA seq 228 aa AA seqDB search
MRLLYILRIYRQRCEGALCGDIWKTIKENLVLYPTPIAKLIDSYSKLPGIGIKTATRLAF
YTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDDPCHICTDTSRDQTTILVVEDAKD
VSAMEKIQEYHGYYHVLHGLISPMNGVGPDDINLKSLITRLMDGKVSEVIVATNATADGE
ATSMYISRVLKPAGIKVTRLARGLAVGSDIEYADEVTLLRAIENRTEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgcggttgctgtacatattacgaatatatcggcaaagatgtgagggcgctttatgtggc
gatatatggaaaacaataaaggagaacttagtgctttatccaacacccattgcaaagtta
attgacagttactctaaacttccaggaattggtatcaagacggcgacgagattagccttt
tatactattggaatgtcaaatgaagatgtcaatgattttgctaaaaatttattagcagct
aaaagagaactgacctattgttcgatttgtggaaaccttaccgatgacgatccttgtcac
atttgcacagacacgagccgtgatcagacgaccattctggtagtagaagatgctaaagat
gtttctgccatggaaaaaatccaagagtatcatggctattatcatgtgcttcacggcttg
atttcgcctatgaatggtgtggggccagatgacatcaaccttaaaagtttaattacccgt
ctaatggatggtaaggtgagcgaagttatcgtagctaccaatgccacagcagatggggaa
gcaacgtccatgtatatttcacgtgtcttgaaaccagccgggattaaggtaactcgtttg
gcaagaggtctcgcagtaggttcagatattgagtatgctgatgaagtaacattattgaga
gctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system