KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1190Help
Entry
M6_Spy1190        CDS       T00191                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00010  Glycolysis / Gluconeogenesis
spa00260  Glycine, serine and threonine metabolism
spa00680  Methane metabolism
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01120  Microbial metabolism in diverse environments
spa01130  Biosynthesis of antibiotics
spa01200  Carbon metabolism
spa01230  Biosynthesis of amino acids
Module
spa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy1190
  Energy metabolism
   00680 Methane metabolism
    M6_Spy1190
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M6_Spy1190
Enzymes [BR:spa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     M6_Spy1190
Membrane trafficking [BR:spa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    M6_Spy1190
Exosome [BR:spa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   M6_Spy1190
  Exosomal proteins of melanoma cells
   M6_Spy1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAT87325
UniProt: Q5XB88
Position
complement(1195699..1196394)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtattg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
ctagacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system