KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1329Help
Entry
M6_Spy1329        CDS       T00191                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00010  Glycolysis / Gluconeogenesis
spa00052  Galactose metabolism
spa00500  Starch and sucrose metabolism
spa00520  Amino sugar and nucleotide sugar metabolism
spa00521  Streptomycin biosynthesis
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01120  Microbial metabolism in diverse environments
spa01130  Biosynthesis of antibiotics
spa01200  Carbon metabolism
Module
spa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy1329
   00052 Galactose metabolism
    M6_Spy1329
   00500 Starch and sucrose metabolism
    M6_Spy1329
   00520 Amino sugar and nucleotide sugar metabolism
    M6_Spy1329
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M6_Spy1329
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    M6_Spy1329
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M6_Spy1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AAT87464
UniProt: Q5XAU9
Position
1317867..1318790
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCLDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAVSAPGAVNKEKGIIEGASAIPYIHHFKIQEALEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDPLALKERRVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactacaataaaggagaacacctcatgagcttgttatgt
cttgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccgttagtgctcctggagcggtt
aacaaggaaaaaggtattatcgaaggagccagcgccattccctacattcaccattttaaa
atacaagaggccttagaagagcggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccccctagcactc
aaagaaaggcgggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagccatttgtcactttaaaaacgaagccaatcttcttggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system