KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1329Help
Entry
M6_Spy1329        CDS       T00191                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M6_Spy1329
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy1329
   00052 Galactose metabolism
    M6_Spy1329
   00500 Starch and sucrose metabolism
    M6_Spy1329
   00520 Amino sugar and nucleotide sugar metabolism
    M6_Spy1329
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M6_Spy1329
   00524 Butirosin and neomycin biosynthesis
    M6_Spy1329
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M6_Spy1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317867..1318790
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCLDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAVSAPGAVNKEKGIIEGASAIPYIHHFKIQEALEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDPLALKERRVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactacaataaaggagaacacctcatgagcttgttatgt
cttgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccgttagtgctcctggagcggtt
aacaaggaaaaaggtattatcgaaggagccagcgccattccctacattcaccattttaaa
atacaagaggccttagaagagcggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccccctagcactc
aaagaaaggcgggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagccatttgtcactttaaaaacgaagccaatcttcttggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system