KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1428Help
Entry
M6_Spy1428        CDS       T00191                                 

Definition
Alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    M6_Spy1428
Enzymes [BR:spa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     M6_Spy1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1423679..1425517)
Genome map
AA seq 612 aa AA seqDB search
MEFSKETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKAEDFLLDDKRQIIGVKARDLLTDQEIIIKAKLVINTTGPWSDEI
RQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLQHPQVTQEDVDYLLGIVNNRFPNANLTINDIESSWAGLRPLLSGNSASDYNG
GNSGKLSDDSFDHLIDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFER
DENGLFTLAGGKITDYRKMAEGALKVIIQVLKEDFGKSFKLINSTTYPVSGGEINPANVD
SELEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLKAAEGLSLAETLSLHYAMD
YEMALKPTDYFLRRTNHLLFMRDSLDALIVPVIEEMAKHFDWSTDEKVKQEEELRRVIAE
NDLSALKGQQED
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaaagagacaagacgtttagctctccaaaaaatgcaagaaagagattta
gacctactaattattgggggaggtattacgggtgctggtgtggcgcttcaagcggcagct
agtggcctagatactggtctgattgagatgcaagattttgcggaaggaacctccagtcgg
tcgaccaaattggttcatgggggacttcgttacttgaaacagtttgacgttgaagtcgtc
tcagatactgtttcagaacgtgctgtggtccaacagattgcacctcatattcctaagcca
gatcctatgttattacctgtttatgacgaacctggcagcacctttagcatgttccgtttg
aaggtcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaaccaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcttg
cttggtggtggcgtttaccttgatttccgcaataatgatgcaaggcttgttattgagaat
attaagcgtgctaatcgtgatggggctcttattgccagccacgtgaaggcagaagatttc
ttgctagatgataaaaggcagattatcggcgttaaggcgcgtgatttattaacagatcaa
gaaattatcatcaaggctaaattggtcatcaataccacagggccatggagtgatgagatt
cgtcaattctctcataagggacaaccgattcatcaaatgcgtcctacaaaaggagtgcat
ttggtagtggaccgtcaaaaattaccggtgtctcaacctgtctatgttgacacagggtta
aatgacggccgtatggtttttgtcttgccacgtgaagaaaaaacttattttgggacaacc
gatacagactacactggagacttgcagcacccacaagttacccaagaagatgtggattat
ttgttagggattgtcaataaccgcttcccaaatgccaacttgactattaatgatattgaa
agtagttgggctggtcttcgtcccttgttgtcaggcaatagtgcctctgactacaatggt
ggcaatagtggtaaactcagcgatgacagttttgaccacttaattgataccgttaaagcc
tatattaaccatgaagatagtcgagaagccgtcgagaaagccattaaacaggtagaaacc
agtacttctgaaaaagaattggatccgtcagcggtatctcgtggttccagttttgagcgt
gacgagaacggcctctttaccttagcaggtggtaagattacggactaccgtaagatggcc
gaaggtgctttgaaagtcattatccaagtcttgaaagaagatttcggcaaatcgtttaag
cttatcaattcaaccacctatccagtttctggcggtgaaattaacccagccaatgtggat
tcagaattggaagcctatgcgcaattaggcacccttagtggactgtccatggacgatgct
aggtatttggctaatctgtatgggtctaatgcaccaaaagtctttgccttaactcgtcaa
ttaaaggccgctgaaggattgagtttagcagaaacgttatctttacactatgcgatggat
tatgaaatggctcttaaaccaacggattatttcctaagaagaaccaatcacctcttgttt
atgcgagatagtctagatgctttaatagtgccagttattgaggaaatggctaaacacttt
gactggtcaactgatgaaaaagttaagcaggaagaagagcttcgtcgtgtgattgcagaa
aatgatttgagtgccctaaaaggccagcaggaggactaa

DBGET integrated database retrieval system