KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1429Help
Entry
M6_Spy1429        CDS       T00191                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425533..1427047)
Genome map
AA seq 504 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGWVEHNANQIWNSVQSV
IAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVWQSRQTAPIAEQLKQDG
HTKMIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGAVH
VTDYSNAARTMLYNIKDLTWDDEILELLNIPKDMLPEVKSNSEIYGKTAAFHFYGGEVPI
SGMAGDQQAALFGQLAFDPGMVKNTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGINGKVH
YALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDSN
ARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNMLM
QFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDMDALKELNATGQLFKASMNESRK
EKLYKGWKRAVKATQVFTQDDDAE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagaaaagtatatcatggctattgatcagggaacaacaagttcacgagcgatt
attttcaatcaaaaaggggaaaaggttagcagtagccaaaaagaattccctcagattttc
ccacacgctggttgggtagagcacaatgctaatcagatttggaattcggttcagtctgtt
attgcgggtgcttttattgaatccagcatcaaaccaagccaaattgaagcaatcggaatt
accaaccaacgtgagaccacagtggtttgggacaaaaaaacgggtgtacctatttataat
gctattgtgtggcaatcacgacagacggcaccaattgctgagcaactcaaacaagatggc
catacaaaaatgatccatgaaaagacaggccttgttattgatgcctacttttctgcaacc
aagatccgttggattttagaccatgttcctggtgctcaagaacgagctgaaaaaggcgag
ttactttttggaaccattgatacttggctggtttggaaactaacagatggtgctgttcat
gtgacggattattccaatgcggctcgtaccatgctctataatattaaagacttaacatgg
gatgatgagattttagagcttttaaatattccaaaagatatgcttccagaggttaaatcc
aattctgaaatttatggcaaaacagctgcctttcatttttatgggggcgaagtgcctatt
tcaggtatggcgggtgaccaacaggcagctttgtttggccaactagcttttgatcctggt
atggtgaaaaacacttatggcacaggttctttcattatcatgaatactggtgatgagatg
cagttatcgagtaataatcttttgaccaccattggttacgggattaatgggaaggttcac
tatgccttggaaggttccatctttattgcaggctctgccattcaatggttgcgagatggt
cttaaaatgattgagacctcaccagagtctgaacagttcgctctagcatcaactagtgac
gatgaagtttatgttgtgcctgcttttaccggtttaggagctccttactgggattctaat
gcgcgtggatctgtctttggcttgacacgtggtaccagcaaagaagactttgtcaaagca
accttacaatctatcgcctatcaagtgcgagatgttattgataccatgcaggtggattca
ggtattgacattcaacaactccgtgtggatggcggtgcagccatgaataatatgctcatg
caattccaagctgatattttggggattgacatcgctcgtgctaaaaatttagaaacaaca
gctctaggggcagctttcttggcagggcttgctgttgggtattgggaagatatggatgct
ttgaaggaattaaacgccactggacaactcttcaaagctagcatgaatgaatctcgcaag
gaaaaactgtataaaggttggaaacgcgctgttaaagcaactcaagtgttcacgcaagac
gatgacgcagaataa

DBGET integrated database retrieval system