KEGG   Spathaspora passalidarum: SPAPADRAFT_55826Help
Entry
SPAPADRAFT_55826  CDS       T03101                                 

Definition
vacuolar alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
spaa  Spathaspora passalidarum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPAPADRAFT_55826
Enzymes [BR:spaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SPAPADRAFT_55826
Exosome [BR:spaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPAPADRAFT_55826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 561 aa AA seqDB search
MSRSKENSPLLGGESLSCYNSKKDKKKVYLSYLLNVVTLSLLAYFFLIPSSHNHDNKNGG
SSGAPPHVDQSKKKNIIMMVTDGMGPASMSAARSFRQFRDGLAINDVLTLDKYLIGSSRT
RSSSSLVTDSAAGATAFSCALKSYNGAIGVRPDSSPCGTILEALKLQGYLTGLVVTTRIT
DATPAAFSSHVDFRSQEDMIAQHQLGEYPLGRMVDLILGGGRCHFYPSGVAGGCRADKRN
LIEEAQRNGTWSYVGDRASFDQLDGGHNVSLPLLGLLADTDIPYDIDRDSTEHPSLAEQV
KVALTALSKATENSEQGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDAAFAEVIKFIDES
DVDTVAISTSDHETGGLVTARQVSEEYPDYLWYPEVLNNSKHSGDFLAQKIYKAKISDEK
KLHKFVTKEILEADMGITNYTEDEVKSVVENASNPAKLLYVLNNILSLRAQIGWTTHGHS
AVDVNIYAYTNSERLNAKLHSKEPYVGLAGNHENIEIGAFMESISTADLHKVTELIQDTE
HSPKKKDSLTADEFHANAVQY
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgttctaaagaaaacctgcctttattgggaggcgaaagcttatcgtgctacaat
tccaaaaaagataaaaagaaggtctacttatcttacctccttaatgttgttaccttatcc
cttcttgcttatttcttcttgatcccatcctcacacaaccatgacaacaagaacggagga
tcttctggtgctccgccacacgttgatcaatccaagaagaagaatatcatcatgatggtc
actgacggtatggggcctgcttctatgtcagctgctcgttccttccgtcaattcagagat
ggtttggcaattaatgatgtcctcacccttgacaagtacttgattggttcttctcgtacc
agatcctccagttctttggttactgattctgctgccggggccactgccttttcctgtgct
ttaaagtcttacaatggtgctattggtgttagaccagatagctctccatgtggtaccatc
ttggaagcattgaagttgcaaggttacttgactgggttggttgttaccactagaatcacc
gatgctacccctgctgctttcagttcccatgtcgatttcagatctcaagaagatatgatt
gctcaacatcaacttggtgaatacccattgggaagaatggtcgatttaatcttgggtggt
ggtagatgtcatttctatccttcaggtgttgccggtggttgtcgtgctgataaaagaaat
ttgattgaagaagctcaaagaaacggaacttggagttatgttggtgacagggccagtttc
gaccaattagatggtggtcacaatgttagcttgccattgttaggtttattggcagatact
gatattccatacgatattgaccgtgactcaacggaacatccttcattagccgaacaagtt
aaggttgcattgactgcactttccaaggctaccgaaaattccgaacaaggattctttttg
ttgattgaaggttccagaattgatcacgctggacaccacaatgatccggctgctcaagtt
agagaagttttagcttacgatgctgcttttgcagaagtcattaaatttattgacgaatca
gatgttgacactgttgctatttctaccagtgatcacgaaaccggtggattggtcaccgcc
agacaagtttcagaagaatatccagattatttatggtatcctgaagtattgaacaactcg
aagcactcgggtgatttcttggcccaaaagatttacaaggctaaaatttctgacgagaag
aagttgcacaagtttgttaccaaggaaatcttggaagctgacatgggtatcaccaactac
actgaggatgaagttaaatccgtcgtggaaaatgcttctaatccagctaagttgttgtat
gttctcaacaacatcttgtcacttagagctcaaattggttggactacacatggacattct
gctgttgatgtcaacatttatgcttacaccaactctgaacgtttgaatgccaaattacat
tcaaaggaaccatatgttggtttagctggtaatcatgaaaacattgaaatcggggcattt
atggaatccatctctactgctgatttacacaaggtcactgaattgatccaagacactgaa
cattctcctaagaagaaggattctttgacagctgatgaattccacgctaatgcagttcaa
tattag

DBGET integrated database retrieval system