KEGG   Spathaspora passalidarum: SPAPADRAFT_59166Help
Entry
SPAPADRAFT_59166  CDS       T03101                                 

Definition
(RefSeq) NADH-cytochrome b-5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPAPADRAFT_59166
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SPAPADRAFT_59166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18872803
NCBI-ProteinID: XP_007373393
JGI: 59166
UniProt: G3AJ52
Position
Unknown
AA seq 296 aa AA seqDB search
MEDKRELLKNPVHSIYIPIGLILFGTWIFSWEYMPYSIAFIVIVCTVKYYEAYKNRSSLH
KTIWQDFELMDKTIIAPMTSIYRFKLRRDDEVLDIPTGHHVACCFNINGKDEIRYYSPIS
NQFDSGFFDILVKHYEHGVVTRRLAQINEGQTVKFRGPFGKLDYKPNMARELVLIAGGTG
ITPILQVITRIITNPDDHTKIKLIFGNETEKDILLKSEIDEIASKYPDFEVYYTVTHPTE
GWTGGSGYVDRAMLEKQLPKANEGNKVFICGPPEMKESLKGITEEMGWESENVFCF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaagataagagagaattgctcaagaatccagttcattccatatacatccctataggg
ttgattttgtttggaacctggatctttagctgggaatacatgccctacagtattgcattc
attgtcattgtttgtaccgtaaagtattatgaagcttacaagaatagatcctccttgcac
aagacaatttggcaagatttcgaattgatggacaagactatcattgctcctatgacatca
atctaccgttttaaattgagaagagatgatgaagtgttagacatacctactggccatcac
gttgcttgttgtttcaatattaacggtaaggacgaaatcagatattattctccaatttcc
aatcagttcgattctggattctttgatattttagtcaagcattacgaacatggtgttgtc
actagaagattggcccaaattaatgaaggtcaaactgtcaagtttagaggaccttttgga
aaactcgactataagcctaacatggctcgtgagttggttttgattgctggtggaacaggt
atcactcctattttgcaagtcatcactcgtatcatcactaatcctgatgaccataccaag
attaagttgattttcggtaatgaaactgaaaaggacatcttgttgaagagtgaaattgat
gagatagcaagcaagtatcctgactttgaagtctactatactgtcactcatccaactgaa
ggttggactgggggatctggatatgttgatcgtgcaatgttggaaaaacaattgcctaag
gctaatgaaggaaataaggtgtttatctgtggtcctccagaaatgaaggaatccttaaag
ggaatcactgaagaaatgggatgggaaagtgaaaatgtcttttgtttctaa

DBGET integrated database retrieval system