KEGG   Spathaspora passalidarum: SPAPADRAFT_63274Help
Entry
SPAPADRAFT_63274  CDS       T03101                                 

Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spaa  Spathaspora passalidarum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPAPADRAFT_63274
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SPAPADRAFT_63274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 304 aa AA seqDB search
MSLSHSFAKLSHPKYLIPIAGVAVASIGLAYQYSTMSTAPISNEAKVTFKGDNEWVDLKL
LKSEDLTHNTKHLTFKLNSEDELSGLVTASCLLTKFVTAKGNNVIRPYTPVSDTEQKGTI
EFVVKKYEGGKMSSHIFDLKENETLSFKGPVVKWKWEPNQFKSISLIGGGTGITPLYQLL
HEITKNPTDKTKVNLIFGNVSTDDILIKKEIDAIANAHKDQVKVTYFVDKAKEGEAWEGK
VGYITKDFLASELDKPSSDTKVFVCGPPGLYKAVSGPKVSPTDQGELTGALAELGYTKEQ
VFKF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttctcattctttcgccaaactttcccaccctaaatatttaatccctattgct
ggagtcgctgttgcttctatcggattagcctaccaatactcaactatgtctactgcccca
atctccaacgaagctaaagtcacctttaaaggtgacaacgaatgggttgacttaaagctt
ctcaaatctgaagacttgactcacaacaccaagcacttgactttcaagctcaattccgaa
gacgaactttccggtttagtcactgcttcttgtctcttgaccaagtttgtcactgctaag
ggtaacaacgttatccgtccatacaccccagtttccgacactgaacaaaagggtaccatt
gaattcgtcgtcaagaagtacgaaggtggtaagatgtctagccacatctttgacttgaag
gaaaacgaaaccttatccttcaagggtccagttgtcaagtggaagtgggaaccaaaccaa
ttcaagtctatttccttgattggtggtggtaccggtatcactccattgtaccaattgttg
cacgaaatcaccaagaacccaactgacaagactaaggtcaacttgatttttggtaatgtt
tccactgatgatattttgatcaagaaggaaatcgacgctattgccaatgcccacaaggac
caagtcaaggtcacttacttcgttgacaaggccaaagaaggtgaagcctgggaaggtaag
gttggttacatcaccaaggactttttagcttccgaattggacaagccttcttctgacacc
aaggtctttgtctgtggtcctccaggtttgtacaaggctgtctctggtccaaaggtttct
ccaaccgaccaaggtgaattgaccggtgctttggctgaattgggttacaccaaggaacaa
gtctttaagttttag

DBGET integrated database retrieval system