KEGG   Staphylococcus pasteuri: STP1_0353Help
Entry
STP1_0353         CDS       T02889                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00860  Porphyrin and chlorophyll metabolism
spas01100  Metabolic pathways
spas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STP1_0353
Enzymes [BR:spas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     STP1_0353
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     STP1_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 MCRA Thi4 HI0933_like Pyr_redox FAD_binding_2 Mqo NAD_binding_9 ApbA Cytochrom_B562
Motif
Other DBs
NCBI-ProteinID: AGZ24664
UniProt: U5UJR6
Position
complement(407058..408461)
Genome map
AA seq 467 aa AA seqDB search
MILSKNVAIIGAGITGLTSAYYMKKQNPQLNVTIYEATNRPGGKIQTYRKDGYTIELGPE
SYLGRKTIMTDIANEIGLGNDLITNTTGQSYIYAKNKLYPIPGGSIMGIPTDIKPFIKTK
LISPLGKLRAGLDLFKKPIEIEDDISVGDFFRQRLGDEVLENLIEPLMGGIYGTNIDDLS
LMSTFPNFKEKEEAFGSLIKGMKDEKEQRIKQRQLYPGAPKGQFKQFKHGLSSFIEALEK
AVKNQGVDIQYNTKVEDIIVSQRDYQVVVDGKNEVYDGVLVTTPQQVFMQWFNHDPAFDY
FNTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSNTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDEEIVSIVRRDLKQMMTFKGDPEFTIVNRLPKSMPQYHVGHIK
QIRKIQEHIKRTYPRLKITGAPFEAVGLPDCIQQGHNAVDDMLEELR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgattttgagtaagaatgtagcaatcatcggtgcaggcataaccggtttaacaagtgct
tactatatgaaaaaacaaaatcctcagttaaatgtaaccatttatgaggcaaccaatcga
ccaggtggaaaaatccaaacatatcgcaaagatggctatacgatcgaattaggaccagag
tcttatttaggtagaaaaacgataatgactgatatagctaatgaaattggattaggtaat
gatttaattaccaatacgacaggtcaatcatacatttatgctaaaaataaattatatccg
ataccaggtgggtctattatgggcataccaacggatataaaaccttttatcaaaactaaa
ttaatttcaccattaggtaaactaagagctggattagatttatttaaaaagcctatcgag
atagaagatgacatatcagtaggtgatttctttagacagcgtttaggtgatgaagtactt
gagaatttaattgaaccactgatgggtggtatctatggtacaaatatagatgacttaagt
ttaatgagtacatttcccaactttaaagaaaaagaagaagcctttggtagcttaattaaa
ggtatgaaagatgaaaaagaacaacgtattaaacaacgtcaattatatccaggtgcacct
aaaggccaatttaaacagttcaagcatggtttaagctcatttatcgaagcacttgaaaaa
gctgttaaaaaccaaggtgtagacattcaatataatactaaagttgaagatattattgta
tctcaaagagactatcaagtggttgttgatggcaaaaatgaagtttatgacggtgtatta
gtcacgacacctcaacaagtatttatgcaatggttcaatcacgatccagcatttgattat
ttcaatacgatggattcaacaacagttgcaacagttgtcctagcatttgatgaaaaagat
attgaaaatacttatgatggtactggttttgtaattgctagaacaagtaatacagatatt
acggcatgtacatggacatctaaaaaatggccatttacaacaccagaaggtaaagtttta
attagagcttatgttggtaaaccaggtgatactgttgtggatgatcatacagatgaagaa
attgtatctatagtacgtcgcgatttaaaacaaatgatgacatttaaaggtgatcctgaa
ttcacaatagttaatcgattaccgaaaagtatgcctcaataccatgtaggtcacattaaa
caaattagaaaaattcaagaacatattaaacgaacatatccacgattaaaaattacaggt
gcgccttttgaagcggttggcctacctgattgtatccaacaaggtcataatgcagttgat
gatatgctagaggaattacgttaa

DBGET integrated database retrieval system