KEGG   Staphylococcus pasteuri: STP1_1102Help
Entry
STP1_1102         CDS       T02889                                 

Definition
putative 4-aminobutyrate transaminase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spas  Staphylococcus pasteuri
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spas00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STP1_1102
   00650 Butanoate metabolism
    STP1_1102
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STP1_1102
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STP1_1102
Enzymes [BR:spas01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     STP1_1102
Amino acid related enzymes [BR:spas01007]
 Aminotransferase (transaminase)
  Class III
   STP1_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1152150..1153487)
Genome map
AA seq 445 aa AA seqDB search
MSKAQDLIKEDEQYFAKSGRIKYYPLAIDHGYGATLVDVDGKEYIDLLASASSQNVGHAP
KKVTEAIKKQVDKFVHYTPAYMYHEPLIRLSKKLCDISPGDYEKRVTYGLSGSDANDGII
KFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKKYGPLLNGFYHIPFPDNYRGLF
EQPNANTVDEYLAPLKEMFDKYVPADEVACIVLETIQGDGGLLEPVSGYFEALESICREH
GILIAVDDIQQGLGRTGKWSSVEHFNFTPDLITFGKSLAGGLPMSAIVGRKEIMETLEAP
AHLFTTGANPVSCEAALATLEMIEEEQLLEASLEKGEYVRQTMDRWVIDYECIGDVRGKG
LSIGIDVVSDPIQKTRDPEAALKICNYCFDKGVVIIAVAGNVLRFQPPLVISYEQLDYAL
STLENAIQALNQGDLDQYEIEGQGW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcacaagacttaataaaagaagatgagcaatattttgctaaatctggaaga
atcaaatattatcctttagccatcgatcatggctacggtgcaacgctagtagatgttgat
ggaaaagagtacatcgacttattagccagtgcaagttcacaaaacgtgggtcatgcgcct
aaaaaagtaaccgaagcgattaaaaagcaagttgacaagtttgtccactatacgccagcg
tatatgtatcacgagccattaattcgcttatctaaaaagttatgcgatatttcacccggt
gactatgaaaaaagagtgacatatggattgagcggttcagatgccaatgatggtattata
aagtttgctcgtgcatatacaggacgaccttatatcatcagttttacaaatgcgtatcat
ggttcaacatttggttcactttctatgtccgcaataagtttgaatatgagaaaaaaatac
ggtccacttttgaacggcttttatcatataccgtttcctgacaattatagaggtctattt
gaacagcctaatgcgaatactgtagatgaatatttagcaccacttaaagaaatgtttgat
aaatatgttcctgctgatgaagttgcatgtattgtattagaaacgatacaaggggatggt
ggtctattagaacctgtgtcaggctactttgaagctttagaaagtatttgtagagaacac
ggtatcttaattgctgttgatgatattcaacaaggattaggacgtactggaaaatggagt
tcagtagagcacttcaactttacacctgatttaattacttttggtaagtcacttgccgga
ggattgcctatgtcagctatcgtcggacgtaaagaaatcatggagacattagaagcaccg
gcacatctatttactactggtgcgaatccagttagttgtgaagcggctttagctacactt
gagatgatcgaagaagaacagttactcgaagcaagtctagaaaaaggtgagtatgtacgt
caaacgatggatagatgggtcattgattatgaatgtattggtgatgtccgtggtaaagga
ttatcaattggtatcgatgtagtatctgacccaattcaaaagactcgtgatcctgaagca
gcattaaaaatatgtaactattgctttgataaaggcgttgttatcatagcagtagcaggg
aatgttttaagatttcaaccaccacttgtaatctcttacgaacaattagattatgcatta
tcgacgcttgagaatgcgatacaagctttaaatcaaggggatttagatcaatatgaaata
gaaggtcaaggttggtaa

DBGET integrated database retrieval system