KEGG   Staphylococcus pasteuri: STP1_1528Help
Entry
STP1_1528         CDS       T02889                                 

Definition
putative carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
spas  Staphylococcus pasteuri
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1617827..1618561
Genome map
AA seq 244 aa AA seqDB search
MMNIKSPSPLYLKGTSQQAILLLHSFTGTVKDVKHLATTLNEQGFTCYVPNYPGHGLPVT
QFIKYDVNDWWACVQEAYQFLKEEGYEVINAAGVSLGGLFTLRLAENVELNRIVVMSAPS
EKTEAGIAWRLEKYGKRMNQIMRLSEDESVESLAQIDQYQDEIKVFQGVINDIMTHLHDI
KSTARILYGGQDEAAYEESAHYIFNQISSDNKSIQDFPLNQHLMTHGEGRDELEQDIVEF
FTQK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattaaatcaccaagtccactttatttaaaagggacaagtcaacaagctata
ctattattacattcattcacaggtactgttaaagacgtgaagcaccttgctacgacgctg
aatgaacaaggcttcacgtgttatgtacctaactatcctggtcatggattaccggttaca
cagtttattaagtatgatgtcaatgattggtgggcatgtgtgcaagaagcgtaccagttt
ttaaaggaagaagggtacgaagtcattaatgcagccggtgtatcgttaggcggattattt
acattacgattagctgaaaatgttgaattaaatcgtatcgtagtgatgtctgcgcctagc
gagaaaacagaagctggtattgcttggcgcttagaaaaatatggcaaacgcatgaatcag
attatgagattatctgaggatgagagtgttgaatcattagcacaaatcgatcaatatcaa
gatgaaattaaagtatttcaaggtgtcattaatgatattatgacacatctacatgatatt
aaatcgaccgctagaattttatatggtgggcaagatgaagcggcttatgaagaaagtgct
cactatatttttaatcaaattagtagtgataataaatcaattcaagattttccactaaat
caacatttaatgacccacggtgaaggaagagatgaattagaacaagatatcgttgagttt
ttcactcaaaaataa

DBGET integrated database retrieval system