KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0039Help
Entry
M28_Spy0039       CDS       T00263                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M28_Spy0039
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M28_Spy0039
   00620 Pyruvate metabolism
    M28_Spy0039
   00650 Butanoate metabolism
    M28_Spy0039
  Lipid metabolism
   00071 Fatty acid degradation
    M28_Spy0039
  Amino acid metabolism
   00350 Tyrosine metabolism
    M28_Spy0039
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M28_Spy0039
   00626 Naphthalene degradation
    M28_Spy0039
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M28_Spy0039
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M28_Spy0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57969..60611
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSVTINALVQKGLAALEEMRKLDQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPATWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFDNLEKSVKIADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIQMNFKAQGIDENEWKEHSRELA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataatactgttgaaacaacctctgtttctgtgacaattaatgctctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttgaccaagaacaagttgat
tatatcgtagccaaagcttctgttgctgccttggatgctcacggtgaacttgctaaacat
gcttatgaagaaacaggtcgcggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtaggaattattgaagaagat
gatgtgacaggtttgacattaattgctgagccggtgggtgttatctgtgggattacaccc
acaactaacccaacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaattatttttgcctttcacccatcagcacaagaatcatcagcacatgccgctcgtatt
gttcgtgatgctgctattgccgctggtgctcctgaaaattgtgtgcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgacggcattgccactatccttgcg
acaggtggaaatgcgatggttaaagcggcatactcatgtgggaaacctgcccttggggta
ggtgctggtaacgttccagcttatgttgaaaaatcagctaatatccgtcaagccgctcat
gatattgtgatgtctaaatcatttgataatggtatggtctgtgcctctgaacaagctgtt
atcatcgataaagaaatctacgacgattttgtagcagaattcaaatcttaccatacttat
tttgtaaataaaaaagaaaaagcccttcttgaagaattctgttttggtgccaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgtaggaaaaccagctacttgg
attgcagaacaagctggatttactgttccagaaggaaccaatattcttgctgcagaatgt
aaagaagtttcagaaaatgagcctttaacacgtgaaaaattatctccagtcattgctgtt
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggactcggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttgga
actagaatccgtgctatccgcgtcatctggaattcaccttctacatttggtggtatcggg
gatgtttacaatgctttcttgccatcattgactcttggttgtggttcgtatggacgtaac
gcagttggtgataatgttagtgctataaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgtgattcaatt
caatatttgcaaaaatgtcgtgacgttgaacgtgtcatgattgttacagatcacgctatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatctttgctgaagtagaaccagatccagacattacaactgttatgaaaggt
actgaattaatgcgtaccttcaaaccagacaccattattgcccttggcgggggatctcct
atggatgcagccaaagttatgtggctcttctacgagcaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgcaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctatcccaacaacttctggaacaggttcagaggtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattactcattaaca
ccaactgtagccattgttgacccagctttggtattgactgttccaggctttattgctgct
gatactggtatggacgttttgacacacgcaaccgaagcttacgtgtcacaaatggccaat
gactttacggatggtttagctcttcaagccattaaaattgtttttgataatcttgaaaaa
tcagttaaaatagccgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacggcgacatggcctaagtataattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttagggcttccagcttctacaccagaagaa
gcagtggaatcttatgcgaaagctgtttatgatctgggttgccgagttggtattcaaatg
aacttcaaagctcaaggtatcgacgaaaatgaatggaaagaacattctcgtgaattggct
taccttgcttatgaagaccaatgttcacctgctaacccacgtcttccaatggttgatcac
atgcaagaaattattgaagatgcttactatggttatgctgaacgtccaggacgacgtaag
tga

DBGET integrated database retrieval system