KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0040Help
Entry
M28_Spy0040       CDS       T00263                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M28_Spy0040 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M28_Spy0040 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    M28_Spy0040 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    M28_Spy0040 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M28_Spy0040 (adhA)
   00626 Naphthalene degradation
    M28_Spy0040 (adhA)
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M28_Spy0040 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60863..61879
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatctt
ccaaatgttggtcatggtgaagcgcttgttaaagtagaatactgtggcgtttgtcatact
gatttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaa
ggtattggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgt
gtctctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgt
gagacactttgtcgcagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaa
tatgcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccggctcaa
gcttcttccattacttgtgctggtgtaacaacttataaagctattaaagaggcaggtgct
gctccaggccaatggattgttatctttggggcaggtggccttggaaatctggctgttcaa
tacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaactt
gagttagctaaagaagttggcgcagatattttagttaacggcaaagaaattgaagatgtt
ccaggctatattcaagaaaaaaccggtggagcacatggtgttgtggtaacggctgtttct
aaagttgcttttaaccaagcaattgatagtgtccgtgccggtggaacagttgtagccgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgctccggttgtcgaaaaagttccagttgacactgctccagaagtcttt
gatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system