KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0073Help
Entry
M28_Spy0073       CDS       T00263                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M28_Spy0073
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M28_Spy0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86573..86881
Genome map
AA seq 102 aa AA seqDB search
MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGS
DVPYCLLSGRAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgatttcaagttaaaagaggagtttccgtttacttggaaaagcggattccc
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
ttatggctccttactcttagccgaaaagatatgatggatattggtataccgattggtagt
gatgtgccttattgcttgctttcaggtcgtgcccaagtcactggtaaaggtgaagtggtt
tgtcgcattttggggctgttatcgtcttgggtggttttggttaaaccagattttggtatc
tcgacttga

DBGET integrated database retrieval system