KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0074Help
Entry
M28_Spy0074       CDS       T00263                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86921..87148
Genome map
AA seq 75 aa AA seqDB search
MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAATTLMTGSGP
TVFALCQTEKQTIIV
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgtctactactcatttggttgcggcgattgaagcgggtaactataatgatgggatattg
actgaaatgaacaatttgctggaagatattttcattgccaagcgaccctttattcaaaaa
ataaaagagaaaacactgcaagctggtgctgctactactttgatgacaggaagtggaccg
actgtttttgctttgtgccagaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system