KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0187Help
Entry
M28_Spy0187       CDS       T00263                                 

Gene name
hasC.2
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00040  Pentose and glucuronate interconversions
spb00052  Galactose metabolism
spb00500  Starch and sucrose metabolism
spb00520  Amino sugar and nucleotide sugar metabolism
spb01100  Metabolic pathways
spb01130  Biosynthesis of antibiotics
Module
spb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M28_Spy0187 (hasC.2)
   00052 Galactose metabolism
    M28_Spy0187 (hasC.2)
   00500 Starch and sucrose metabolism
    M28_Spy0187 (hasC.2)
   00520 Amino sugar and nucleotide sugar metabolism
    M28_Spy0187 (hasC.2)
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M28_Spy0187 (hasC.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAX71301
UniProt: Q48VF5
Position
complement(201797..202702)
Genome map
AA seq 301 aa AA seqDB search
MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTG
KSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKT
FVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP
QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTK
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttt
ttacctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactatt
caatttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactgga
aaatccaaacgctccatagaagatcattttgattctaattttgaattagaatataattta
caggctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaacctt
cactttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacc
tttgttggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaat
ccaaatgtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgca
actattgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcct
caagcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacct
caagatgcacctagtgatttggcaattattggacgttacttgctcacaccagaaattttt
agtattttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctatt
gataccctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgat
gttggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaa
gtcaaagatgacttgaaagcctacatcatccaactgggcaaagcactagagaaaacaaaa
ccataa

DBGET integrated database retrieval system