KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0396Help
Entry
M28_Spy0396       CDS       T00263                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:spb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403570..404397
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTLPGQIIQSVGRRGKYL
LIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAK
SQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLW
AAKVHPGTASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVY
GQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggtccgacgagggcttgagactttagtgcttggc
caagaaattgtggctgttacgcttaaagtgccaaagatggttaaaaccgacttagagacg
tttgccctgaccctacctggtcaaatcattcagtcagttggccgtcggggaaaatattta
ttaattgatttggggcaattagtgttggtatcacatttgcggatggaaggcaaatatttg
ctttttccagatgaggtccctgataacaaacactttcatgtcttttttgaattgaaaaat
ggttcgaccttggtttaccaagatgtgcgtaaatttggaacctttgatttgatagcaaaa
tctcaattatcagcgttttttgccaaacgaaaactaggccctgaaccaaagaaagagacc
tttaagttaaaaacctttgaggctgctctgctatcctcccaaaaacccataaaaccacat
ctgttagaccagaccttggttgctggtttagggaatatttatgtggacgaggtactttgg
gctgctaaggttcatccaggaactgcgtcttctaggttgaataaggcggagataaaacgg
ctgcatgatgaaaccatacgaatcctagctttaggaattgaaaagggcggttcgaccgtc
cgtacttaccgtaatgctttgggagctgatggcaccatgcaggactatttgcaggtttat
ggtcaaactgggaaaccgtgtcctcgttgtggacaggctattgtcaaattaaaagttgga
ggaagggggacgcacatttgtccaaaatgccagaaaaaaagaccatga

DBGET integrated database retrieval system