KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0482Help
Entry
M28_Spy0482       CDS       T00263                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    M28_Spy0482
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M28_Spy0482
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M28_Spy0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484685..485083)
Genome map
AA seq 132 aa AA seqDB search
MIVNTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYH
TTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDP
KLIEEDLKALLG
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttaacacagctaccaagtgtggattaaccccacaataccaggccctgcaagca
ctatatgacacataccatgacaagggatttgaggtcttagattttccttgcaaccaattt
ttaaatcaagctccaggagatgctgaggagattaatcacttttgcagtctgacctatcac
actactttccctcgctttgctaaaatcaaagtgaatggtaaagacgctgatcctttgttc
acctggttaaaagaagaaaaaagtggtccccttgggaaacgcatcgaatggaatttcact
aaatttctcattgaccaaaatggtcaagtcattaaacgctattcctcaaagacagatcct
aaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system