KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0715Help
Entry
M28_Spy0715       CDS       T00263                                 

Gene name
cpsFP
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:spb00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:spb00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735618..736211
Genome map
AA seq 197 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKL
QNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMF
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEAD
KNHPLLSDVKPLKPKDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaaaagaaaaaatgttgccaattggctttccagaacgtttttttgaggaaggaaaacta
caaaacaacgtttctttttcacgtcagcatgtgctgcgtggacttcatgctgaaccttgg
gataaatacatctcagttgctgatgatggcaaggttttaggagcttgggttgatcttcgt
gagggagagacttttggaaacgtctaccagacagtgattgatgcttcaaaaggaatgttt
gttcctagaggggttgctaatggctttcaagttctttcagagactgtctcttacagttat
cttgtcaatgactactgggctcttgacttgaaacctaagtatgcttttgtaaactatgct
gacccaagtcttgggattacttgggaaaatctagcagctgcagaagtttctgaagcagat
aaaaaccatcctcttcttagtgatgtcaaaccactgaaaccaaaagacctatag

DBGET integrated database retrieval system