KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0715Help
Entry
M28_Spy0715       CDS       T00263                                 

Gene name
cpsFP
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00521  Streptomycin biosynthesis
spb00523  Polyketide sugar unit biosynthesis
spb01130  Biosynthesis of antibiotics
Module
spb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M28_Spy0715 (cpsFP)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M28_Spy0715 (cpsFP)
Enzymes [BR:spb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     M28_Spy0715 (cpsFP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF4152
Motif
Other DBs
NCBI-ProteinID: AAX71828
UniProt: Q48TX8
Position
735618..736211
Genome map
AA seq 197 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKL
QNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMF
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEAD
KNHPLLSDVKPLKPKDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaaaagaaaaaatgttgccaattggctttccagaacgtttttttgaggaaggaaaacta
caaaacaacgtttctttttcacgtcagcatgtgctgcgtggacttcatgctgaaccttgg
gataaatacatctcagttgctgatgatggcaaggttttaggagcttgggttgatcttcgt
gagggagagacttttggaaacgtctaccagacagtgattgatgcttcaaaaggaatgttt
gttcctagaggggttgctaatggctttcaagttctttcagagactgtctcttacagttat
cttgtcaatgactactgggctcttgacttgaaacctaagtatgcttttgtaaactatgct
gacccaagtcttgggattacttgggaaaatctagcagctgcagaagtttctgaagcagat
aaaaaccatcctcttcttagtgatgtcaaaccactgaaaccaaaagacctatag

DBGET integrated database retrieval system