KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0798Help
Entry
M28_Spy0798       CDS       T00263                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818876..819484
Genome map
AA seq 202 aa AA seqDB search
MKRKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGL
GKDPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLA
RAVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTT
ARGLYKESRAERQEVISLMTKD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaa
aaagcagaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaa
ggtcttcttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactg
ggaaaagatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtg
attgtcaaagacattagtttttattctatatgtgaacaccacttagttcctttttatggc
aaggctcatatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcg
cgagcagttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaata
gcggatgctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagag
cacatgtgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccact
gccagaggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgaca
aaagattag

DBGET integrated database retrieval system