KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0799Help
Entry
M28_Spy0799       CDS       T00263                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00790  Folate biosynthesis
spb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M28_Spy0799 (folP)
Enzymes [BR:spb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     M28_Spy0799 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAX71912
UniProt: Q48TP8
Position
819493..820293
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWVDPGFG
FAKSVQQNTELLKGLDRVCHLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggggctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgaccgggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttgggttgatccaggatttgga
tttgccaaatctgttcaacagaatacggagttattaaaaggattggaccgcgtctgtcat
ttgggctatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggaaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

DBGET integrated database retrieval system