KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0801Help
Entry
M28_Spy0801       CDS       T00263                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M28_Spy0801 (folK)
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     M28_Spy0801 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820656..821156
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEFYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKFLRDYLAALDQSDITLFSAQQTEF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgggggaccgagcagcttacttgcaa
aaagctcttgaggctttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacgactgcttggggcaagacaggccaggctgattttctcaatatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgacattgatatcttgcta
tttggagaagagttttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagtttttaagggattatcttgcagctttagatcaatcagatatcacgctcttttca
gctcaacagacagagttctag

DBGET integrated database retrieval system