KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0811Help
Entry
M28_Spy0811       CDS       T00263                                 

Definition
Zn-dependent alcohol dehydrogenase and related dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M28_Spy0811
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     M28_Spy0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(831024..832004)
Genome map
AA seq 326 aa AA seqDB search
MNWLITSQPYKELNMKAATYLSTGNLQLIDKPKPVIIKPTYRPVGKNHSICGTDLHILGG
DVPACKEGTILGPEGIGIVKEIGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCEDG
GWILGHLINGTQAEYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKPG
DNVCIVGAGPVGLAALLTVQLFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKAI
IDDITNGRGVDISMECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNITL
NTGLVNANTTEMLLNVLKVIIDNDIS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgattacctctcaaccttataaagagttaaatatgaaagcagcaacttac
ctttcaaccggaaatctacagctcatagacaaaccaaaaccagtcattataaagcctaca
tatcgtccagttggtaaaaaccactctatttgtggaactgatttgcatatcttaggtggg
gatgttcccgcatgtaaagaaggaacaatccttggtcctgaaggaattggaattgttaag
gagatcggtgatgcggtcactaactttaaaatcggagataaagtgattatttcttgcgtc
acatcatgtcatacctgttattattgtaaacgaggcctttcgtcacattgtgaagatggc
ggttggattcttggccatttaattaatggaacacaagcagaatatgtccatatcccacat
gcagatggtagtctctatcatgctcctgatacgattgatgatgaggcactggtcatgctt
tctgatattttaccaacttcatatgaaattggtgtcttgccatcacatgtcaagcctgga
gataatgtttgtattgttggtgccggtccagtaggactcgcagccctactaaccgttcaa
cttttctctccagccaatattattatggtcgacttatctcaaaatcgccttgaagcagct
aaaacgtttggagccacacacacgatttgttcaggaagtagtgaagaagtcaaggctatc
attgacgatataaccaatggacgtggtgtcgatatttccatggagtgtgttggttatccc
gcgacatttgatatttgccaaaaaattatatcagtaggtgggcatattgctaacgttggg
gttcatgggaaaccagttgatttcaacctggatgaattatggattaaaaatatcacctta
aacactggacttgttaatgccaatacaactgaaatgctactaaatgtcttgaaagttatt
attgataatgatattagctaa

DBGET integrated database retrieval system