KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0883Help
Entry
M28_Spy0883       CDS       T00263                                 

Gene name
citC
Definition
[citrate (pro-3S)-lyase] ligase (EC:6.2.1.22)
Orthology
K01910  
[citrate (pro-3S)-lyase] ligase [EC:6.2.1.22]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:spb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M28_Spy0883 (citC)
Enzymes [BR:spb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.22  [citrate (pro-3S)-lyase] ligase
     M28_Spy0883 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(899227..900279)
Genome map
AA seq 350 aa AA seqDB search
MPYYTISKVFPSDKTTMASVKNLLHQEGIRLDAHLDYTCAIMNAQNDVIATGSYFGNSLR
CLCVSSAYQGGGFLNRIVSHLIDEEYALGNYHLFVYTKTSSAAFFKDLGFTEIVHIDNHI
SFLENKKTGFQDYLMTLNKPEQTPGKVAAIVINANPFTLGHQFLVEKAARENDWVHLFMV
SEDQSLVPFSVRKMLIQEGLKHLDNIIFHETGPYLISQATFPAYFQTEDNDVIKSQALLD
TAIFLKIAQTLQITKRYVGEEPTSRVTAIYNEIMAEQLQQAGILLDILPRKAINQQQDPI
SASTARQALKDSDWDLLAKLLPKTSLDYFCSLEAQPIIKKIQATSSVKHY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccttactacactatttcaaaagtctttccttcagataaaacgacaatggctagtgta
aagaacctgcttcatcaagaaggtattcgtttggatgctcatttagattatacttgtgcc
atcatgaatgcgcaaaatgatgtgattgctaccggttcttactttggaaatagcttgcgc
tgtctttgcgtatccagtgcctatcaaggtggaggatttcttaataggattgtgagtcat
ctcattgatgaagaatatgcccttggcaactatcatctttttgtttatacgaagacctct
tctgctgcttttttcaaagatcttggttttactgaaattgtccatatcgacaatcacatc
agtttcttggaaaataaaaaaactggttttcaagattatctgatgacacttaataagcct
gagcaaacacctggtaaagtcgctgctattgttatcaacgctaacccctttaccttaggg
catcaatttttagtagagaaagctgcaagagaaaatgattgggttcatctgtttatggtc
agtgaggaccaaagcttggttcctttttcagtacgaaaaatgttgattcaagaaggattg
aaacatcttgataacattatctttcatgaaacaggtccttatttgattagtcaggcaacc
tttccagcttatttccaaacggaagacaatgatgtgatcaaaagccaagctttgctggat
actgctatttttctaaagattgctcaaaccttacagattacaaaaagatacgttggagaa
gagccaaccagccgagtaactgctatttacaatgaaatcatggcagagcagttgcagcaa
gctggtatcctcctagatattttgccaaggaaagctatcaatcagcagcaagatcctatc
agtgcctcaacggctaggcaggcattgaaagatagtgattgggaccttctggcaaaactc
cttcccaaaacgtctttagattatttttgttcgctagaagcccaacccattattaaaaag
atacaagccacttcatctgtcaaacattactaa

DBGET integrated database retrieval system