KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1158Help
Entry
M28_Spy1158       CDS       T00263                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M28_Spy1158 (gpmA)
   01230 Biosynthesis of amino acids
    M28_Spy1158 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M28_Spy1158 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    M28_Spy1158 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M28_Spy1158 (gpmA)
Enzymes [BR:spb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     M28_Spy1158 (gpmA)
Exosome [BR:spb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   M28_Spy1158 (gpmA)
  Exosomal proteins of melanoma cells
   M28_Spy1158 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1164370..1165065)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtattg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagctcttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgatggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system