KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1158Help
Entry
M28_Spy1158       CDS       T00263                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00010  Glycolysis / Gluconeogenesis
spb00260  Glycine, serine and threonine metabolism
spb00680  Methane metabolism
spb01100  Metabolic pathways
spb01110  Biosynthesis of secondary metabolites
spb01120  Microbial metabolism in diverse environments
spb01130  Biosynthesis of antibiotics
spb01200  Carbon metabolism
spb01230  Biosynthesis of amino acids
Module
spb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M28_Spy1158 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    M28_Spy1158 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M28_Spy1158 (gpmA)
Enzymes [BR:spb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     M28_Spy1158 (gpmA)
Membrane trafficking [BR:spb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    M28_Spy1158 (gpmA)
Exosome [BR:spb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   M28_Spy1158 (gpmA)
  Exosomal proteins of melanoma cells
   M28_Spy1158 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAX72268
UniProt: Q48SP2
Position
complement(1164370..1165065)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtattg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagctcttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgatggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system