KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1345Help
Entry
M28_Spy1345       CDS       T00263                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    M28_Spy1345 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    M28_Spy1345 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M28_Spy1345 (lacZ)
Enzymes [BR:spb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     M28_Spy1345 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327950..1331456)
Genome map
AA seq 1168 aa AA seqDB search
MVYRQKSSEIVTRTITKPSRATSNVKQEIDMTPDSKEQTVTGYQYHYIDQEGRKQPFNQG
WRFLMADVACAQDPSFDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVL
DEVLAGCHVAITFEGSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVTFGAENLLAVRVE
NKVPSSRWYSGSGLYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQSI
QTCHYQLSLCLWEQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHL
YDLELTLYYQGQVIDCFCLETGFRQLTFMANQGLFVNGRAVKLKGVCLHHDQGGLGACAY
EDALARQLVLLKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDF
SNYFHQTIGTENASYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSAD
VSHYPELTRQMCQWIAAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIG
LNYANGKDYDKLHEEHSDWLLYGSETASAITSRAYYKETKKVLDSGYHLTSYDHAKVDWG
AFASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAG
FPKDSYYFYQSQWAQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGN
VTDYGRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKS
IPKTSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSRGELVSHAQDWLKVQV
EGPAHLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKVSQQLSSVFQ
TQVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKTTQFLSVLENKDTQQKAGKVS
TPHILITSYQHYLSLPLQVCSQAFDFKKGDDIFLPQWLQVKDAQGSFVKKAFPMTWYLKE
KIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLATSQKRLTYCYQY
DTVQAIGAISLQNHTDTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDILTV
LYLVVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcgccaaaagagttcagagatcgttacaaggacaattaccaagccatcaagg
gcgaccagtaacgtcaaacaggagattgatatgacaccagatagcaaggagcagacagtg
actggctaccaataccactatattgatcaagaaggaagaaagcagccctttaatcaaggc
tggcgttttcttatggcagatgtggcgtgtgctcaggacccttcttttgatgattcgaac
tggcaggtgattcatttaccacatgatttcagtcttacgcagccttacacaagaaatggt
gaagctgaaagtgcttataaattaggtggtgtcggttggtatcggcattatctcgtgtta
gatgaggttttagctggttgtcatgttgccattacttttgagggttcctatatggaaacg
gaaatttatgttaacgggcaattcattggcaaacacttaaatggctatcaggaatttact
tatgatatctctgatgttgtgacttttggagctgaaaatcttctggctgtccgggttgaa
aacaaggttcccagttctcgttggtattcaggcagtggtctttatcgtgaagtgagtttg
tctgttcttccccagcttcattttgtggcagaccaggtagcaatgaccttggctgatact
gctgtgcaggagaaagggcaacagaaagttgatttacgctttgccctcaatcagtctatt
cagacttgccactaccaattgagcctctgtttatgggaacaatcacattgctcaaaagac
aagaaactcctttatcaagaaacagaagtgcctctagctgatttggctttccaaagacag
tatggtcttacactgtctttggaagaactccaattgtggtcaccagataatcctcacctc
tacgatttagaactcactctttactatcaaggtcaggtcattgattgcttttgccttgaa
actggttttcgtcagctgacttttatggccaatcaggggctttttgtgaatggcagagct
gtcaaattaaagggagtttgtttgcatcatgaccaaggaggcctaggagcttgtgcttac
gaagatgccctagccagacaattagtcctgttgaaagacatgggggctaataccattcgt
agcacccataacccaagtagtcccaaacttaggcaactagccaatcgtctcggctttttt
gtgattgaagaagcctttgacacctggacctatgccaaaaatggaaatgttaatgacttt
tcaaactatttccatcagaccatcggaactgaaaatgcaagctatcttcaaagagtgagg
tcacctgaaacgagctgggcccagtatagtattgaggccatggtctggtctgccaagaat
gacccgtcagtgttgatgtggtcgattgggaatgaattgatggaaggtttttcagccgat
gtcagtcattacccagagctaacaagacaaatgtgccaatggattgctgctattgacacc
tcacgtcccattacctttggggacaataaattaaaagaagctgacttttgctggcatgag
gaagtgtcgcaaatggcaactcttcttagtcaattagaccatccccagggactcattggg
ttaaactatgctaatggaaaagactatgataagcttcatgaggagcactctgattggctg
ttgtatggttctgaaacagcctcagccattaccagcagggcttattataaagagacaaaa
aaagttcttgactccggttatcacctaacctcttatgatcatgctaaggtcgattggggt
gcattcgctagccaggcttggtatgataccattacccgtgattttgttgctggcgaatgc
gtttggacaggctttgattatttaggagaacctacaccctggaacaagatcgacagcggt
gttgtaggcctttggccttctcctaaaaatgcctactttggcattttagacacggcaggc
tttccaaaagatagctattatttttaccaaagtcagtgggcgcaggggcagaccaccttg
cacctgttaccagtctggcagaaggaccagctttgtttcgatgagcagggattggtggag
gttgtggtttatagcaatgctgccagtgttcaactgatgtttgaagatgagcagggcaac
gtaacagattatggaaggaaggcatttcatacttatagcacgccaacgggacacacttat
cagctttaccaaggagctgacgctgctaagaatcctcacgagaatctttacctgacttgg
cgagtgccctatcaaaaagggttgctaagggcagtggcctacgacatttctggtaaaagc
attccaaaaaccagtggacgttctcaggttagaacctatggttcagtggcaaagctatct
tggaaagcctttgaagcacctattgacgctccttgggaattgctttatctggatttatca
ctcttggatagccgaggtgaattggtcagccatgctcaagattggctaaaggttcaagta
gaaggaccagcccatttgttggctcttgataatgggaatccgactgaccacaccccttat
caggagcctctacgccaggcatatgggggaaaattattagccattttagccctcactgga
gaggcgggacacattaaggtcacggcaaaagtctcgcagcaacttagcagtgtttttcag
acacaagtagcctgccgtgcccccaaagaacacttagtgacactacctttagagaaatat
cagtttaaaaagagccgactgacaagtcaacaagaaattggtcaatcttgtctaaagacc
acacaattcctttctgttttggagaacaaagacacccagcaaaaagcaggtaaggttagc
acacctcacattcttatcaccagttaccagcactatttatctctgcccttgcaggtttgt
tctcaggcatttgattttaaaaaaggcgacgatatcttcttgcctcagtggctccaagtc
aaagatgcccaaggttcttttgtgaaaaaagcttttccaatgacatggtacctaaaagag
aaaatctttgccaagcctattcttgtcacgggctatgtttcttgttttgggcaatcaata
ccggttgaggcaaggcttaacctagcacaagctagcaaaagacggcaccaggatctcagt
ttagtcgccaagcaatccctggccacaagtcaaaaaaggctaacttattgctaccaatat
gatacggtgcaagccataggagccattagcttgcaaaatcacacagacacatctcttagt
gtttctgtggcaatcagttatggtagtcagagctctattaagcaagaaaccttgatgcta
gctgatagccacttgagccagttagaagaggttattttcttcgatgatattttgactgtt
ttgtatctagtagtgacccttgaagtcattgaaggacctgacctaactgaagacagtatt
caaattggcctttgggatttagcatga

DBGET integrated database retrieval system