KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1382Help
Entry
M28_Spy1382       CDS       T00263                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M28_Spy1382 (gmk)
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     M28_Spy1382 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1378077..1378712)
Genome map
AA seq 211 aa AA seqDB search
MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRPQRPGEVDGVDYFFRTRE
EFEELIKTGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKSKVPDGVF
VFLTPPDLDELEDRLVGRGTDSQEVIAQRIERAKEEIALMREYDYAVVNDEVALAAERVK
RIIETEHFRVERVIGRYDKMIKITKNPFKAK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcggtttgttaatcgtcttttctggcccttcaggtgtcggaaaaggaacg
gtaagacaagaaattttttcaacgccagatcataaatttgaatattcggtttcaatgacg
actcgtccgcaaagaccgggcgaggttgatggggttgattatttcttccgcacacgtgaa
gaatttgaagaactcattaaaactggtcaaatgctagagtatgctgaatatgttggtaat
tactatggcacccctttaacttatgttaatgagactcttgataagggaattgatgtcttt
ttagaaattgaagttcaaggagctcttcaggttaagtcaaaagtaccagatggtgttttt
gtttttttaacaccaccagatttagatgaattagaagaccgcctggttggtcgtggtaca
gatagtcaagaagtcatagctcaacgtattgaaagagcaaaagaagaaattgcccttatg
cgcgaatacgattatgcagttgttaatgatgaagttgccttggcagctgagcgggttaag
cgtatcattgagacagaacactttcgtgtggagcgcgtgattggtcgttatgataaaatg
attaaaataacaaaaaatccctttaaagctaaatag

DBGET integrated database retrieval system