KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1388Help
Entry
M28_Spy1388       CDS       T00263                                 

Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00072  Synthesis and degradation of ketone bodies
spb00650  Butanoate metabolism
spb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    M28_Spy1388
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    M28_Spy1388
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     M28_Spy1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase DUF3783
Motif
Other DBs
NCBI-ProteinID: AAX72498
UniProt: Q48S12
Position
1384211..1384990
Genome map
AA seq 259 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETFLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYNSAKHGLIGLTKVTALEAADSGITVN
AICPGYVDTPLVRGQFEDLSKTRGIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASD
KAKGVTGQACILDGGYTAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcgggattggaaaacaa
atcggggaaaccttcttaaaagaaggtaaaacggttgttttttctgacattaatcaagaa
aaactggatcaggttgttgctgactatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggccttcaacatgttgccatgattgaagat
tttccaactgaaaaatttgaattcatgattaaaatcatgttgacagcaccatttattgcc
attaaacgtgcttttcctacaatgaaagctcaaaaacacggtcgtattattaatatggct
tctatcaatggtgtcattggttttgctggcaaatccgcctacaattcagctaagcacggc
ttgatcggtctgaccaaagtaactgccttagaagctgctgattcaggcattacggtcaat
gccatttgtcctggatatgttgacacaccactggttcgtggccagtttgaagacctttcc
aaaacaagaggtattccccttgaaaatgttcttgaagaagtgctatacccacttgttcct
caaaaacgcctcattgacgttcaagaaattgcagactatgtgtctttccttgccagtgat
aaggcaaaaggtgttacaggtcaagcctgtatcttagacggtggctacactgctcaataa

DBGET integrated database retrieval system