KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1554Help
Entry
M28_Spy1554       CDS       T00263                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M28_Spy1554 (recD)
Enzymes [BR:spb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     M28_Spy1554 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1551653..1554016
Genome map
AA seq 787 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESGSPKRFRAALLHCLLEESINRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIANNIS
RLLDTPLSQSFSHDTIQTTIQAVQKDFAITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILAADFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQSTNSNPTENSQSDNDDFRLTPENYSTIDSMIGLTESDIA
LFFQKKS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaagattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggagaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagcgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcactatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggcctatctaaggctaatcgtcaagcctttgtc
gctaaactaaaattgaattacggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgaaaagtataaagaagaggctcttgacctt
gttaaagaaaatccctatcagttagtcgaagatctacaaggttttgggtttaaaatggca
gatgctctcgctgaaaacttagggattgaaagcggctctccgaaacgttttcgtgcagcc
ctccttcactgtctcttggaagaatccatcaatcgaggagatacttatgttcaagcacga
caattattagactttgccattacactccttgaagatgcacgtcaagtagaatgtgatcct
gctgctgtggctgaacaactaagcgagttgatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctaacaacatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccattcaaacaaccatc
caagccgttcaaaaagactttgccatcacctatgaccaagtgcagcaagaagccattact
aaggccttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaatggcgacaacgattac
caagccatggaggattatctagactgcgacctgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagctattaattcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatacaccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccctggcctat
gccatgagcattcataaatcgcaagggagtgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caatcaacaaactctaaccccactgagaactctcagtcagataatgatgattttaggtta
acacctgagaattattcgactatcgattcgatgatagggcttacagagtcagatattgcc
ctctttttccagaaaaaatcctag

DBGET integrated database retrieval system