KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1886Help
Entry
M28_Spy1886       CDS       T00263                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spb00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spb00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880398..1881312
Genome map
AA seq 304 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAPQG
KAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQTPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPEVKEDLKNYIIKLGKALEKSKVP
THSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgctgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaggactatgacaagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaagggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacagacccctggagcaggtaacgaagtgcaactcacagatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaatttaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacatctatcgactatgccttagaacacccagaggtcaaa
gaggacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtaaagtacca
acacattcaaagtaa

DBGET integrated database retrieval system