KEGG   Shewanella putrefaciens CN-32: Sputcn32_0082Help
Entry
Sputcn32_0082     CDS       T00513                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00330  Arginine and proline metabolism
spc00332  Carbapenem biosynthesis
spc01100  Metabolic pathways
spc01130  Biosynthesis of antibiotics
spc01230  Biosynthesis of amino acids
Module
spc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sputcn32_0082
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sputcn32_0082
Enzymes [BR:spc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sputcn32_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF4543
Motif
Other DBs
NCBI-ProteinID: ABP73818
UniProt: A4Y1I5
Position
complement(91337..92437)
Genome map
AA seq 366 aa AA seqDB search
MTNSPRKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQGIQVVLVSSGSVAAGWH
HFNVEANPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRERYISIKETIF
CLLEHGLMPIINENDAVTADKLKVGDNDNLSAMVAAAADADTLIICSDVNGLYTQNPHEN
PNAELIKQVTEINADIYAMAGGASSNVGTGGMRTKIQAAEKAISHGIETFIINGFVADSF
SQLLKGQNPGTLFIPDEKPMQEHLHWMKHTSQAQGEVIVENHFNVALDVHSEQFTSDDVV
EVKGDFSVGDTILVRKDDGTKLAKAKSNYSSCLLNFITEQEDRQFANEFQQKTGPIISGK
NIAILE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactcccctcgaaaacgcattgttgtaaaagtggggagcgcgttaatcgcgccc
cacaaacaaggttgtagcagccactacttactcggtatagcccaattcattacctattgt
cgtgcccaagggatccaagttgtcttggtctcttcgggctcagtcgccgcgggatggcat
cactttaatgttgaagcgaatccgagtgtcacagtgaaaaaagccatggctgcagcaggt
caagccgatatgatggccacatggaataaactgtttgacttccccacagcacaactctta
ctcacccatggcgaccttcgtaatcgcgagcgctatatcagcattaaagaaacgattttc
tgtttgcttgaacatgggctgatgccaattattaacgaaaatgatgcagttaccgcggac
aaactcaaagtcggtgataatgacaatctttcggccatggttgccgcagcggccgatgct
gatacgctgattatttgttcagatgtaaacgggctgtatactcaaaatccccatgaaaat
cccaatgccgagttgattaaacaggtcactgagattaatgccgacatctatgccatggcg
ggtggtgcgagcagtaacgtgggtactggtggcatgcgaacgaaaatccaagcggcagaa
aaagccatttcccatggaattgagacctttattatcaatggctttgttgcggattccttc
agccaactgcttaaaggccaaaaccctggcaccttgttcatccctgacgaaaaacccatg
caagaacatttacattggatgaaacacacttcacaagcccaaggtgaagtcatagtcgaa
aaccattttaatgtcgcactcgatgtgcacagcgaacagtttaccagtgatgatgtggtt
gaagtaaaaggggatttctcagtaggtgacaccattctagtacgcaaagacgatggcact
aaactggctaaagctaaatccaattacagcagttgcctactcaattttattacagagcaa
gaagatcggcagtttgccaatgaatttcagcaaaaaacaggccccatcatttccggcaaa
aacatcgccattcttgaataa

DBGET integrated database retrieval system