KEGG   Shewanella putrefaciens CN-32: Sputcn32_0497Help
Entry
Sputcn32_0497     CDS       T00513                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00860  Porphyrin and chlorophyll metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
Module
spc_M00121  Heme biosynthesis, glutamate => heme
spc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sputcn32_0497
Enzymes [BR:spc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sputcn32_0497
Exosome [BR:spc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sputcn32_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABP74229
UniProt: A4Y2P6
Position
complement(543297..544304)
Genome map
AA seq 335 aa AA seqDB search
MNIITSAFPQRRMRRMRKHDFSRRLMAENHLTVNDLIYPMFILEGTNRSEKIASMPGVER
YSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADALVQRAVRELKKAFPQL
GIMTDVALDPFTTHGQDGIIDETGYILNDITTDILVKQALSHAEAGADIIAPSDMMDGRI
GAIRQALEAAGHVNTQIMAYSAKYSSSYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAYQVSGEYAMHMAAIQNGWLA
EKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattattaccagtgcttttccacagcgcagaatgcgccgcatgcgtaaacatgat
tttagtcgtcgattgatggccgaaaatcatctaacggtcaatgacttgatttacccaatg
tttatccttgaaggcactaatcgtagtgaaaaaattgcctctatgccaggtgtcgaacgc
tactcgatagacttgctactgaaggaggctgaagaactggttgagttaggtattccattg
atcgcacttttccctgtgacacctgcagagaaaaagacattaatggcagaagaagcctat
aacgcagatgccctagtacaacgtgctgtgcgcgagctcaaaaaagcctttccacagctc
ggcatcatgacggacgtggcactagatcccttcaccactcacggtcaagacggcatcata
gacgaaacaggttatatccttaacgatatcacaaccgacattctcgtgaagcaagcgcta
tcgcatgcagaagctggcgcagatatcattgcaccatcagatatgatggatggccgtatt
ggtgcaatacgccaagcacttgaagcggctggtcatgtgaacacccaaatcatggcttac
tcagcaaagtactcatcaagctactatggcccattccgcgatgctgtcggttcagcaggc
aatctaaaagggggcaataaacacagctaccaaatggatcctgcaaacagtgatgaagca
ttgcacgaagtcgcactggatattcaggaaggtgcagatatggtcatggtcaaacctggt
atgccttatttagatatagtgcatcgtgtcaaaaccgaacttgcagtgccaacattcgct
tatcaagtcagcggtgaatacgccatgcatatggcagcaatccaaaacggttggttggca
gaaaaggcgatcgttatggagtccctactctgcttcaagcgtgctggagccgatggtatt
ctcacatatttcgccaaacgcgcagctcagtggcttaaagaagcctag

DBGET integrated database retrieval system